Labshake search
Citations for Evrogen :
1 - 31 of 31 citations for Human PRPF31 shRNA Plasmid since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2020Quote: ... plasmid # 162785 Plasmids for cell transfections were purified by the Plasmid Midiprep kit (Evrogen, Moscow, Russia) and concentrated by ethanol precipitation in sterile conditions.
-
bioRxiv - Microbiology 2020Quote: ... Plasmid and chromosomal DNAs were isolated with Plasmid Miniprep (Evrogen, Russia) and PurElute Bacterial Genomic Kit (Edge BioSystems ...
-
bioRxiv - Molecular Biology 2021Quote: ... Plasmid DNA for transfection was isolated using Plasmid Miniprep Kit (Evrogen, Russia) according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2022Quote: ... and plasmid DNA was isolated using the Plasmid Miniprep/BC021S kit (Evrogen, Russia). The bla gene sequence and pblaTEM plasmid type were confirmed by PCR and Sanger sequencing.
-
bioRxiv - Cell Biology 2020Quote: ... KillerRed plasmid (FP966) was purchased from Evrogen. Recombinant human GCase (rGCase ...
-
bioRxiv - Microbiology 2022Quote: ... 200 ng of plasmid pTagRFP-C (Evrogen), which expresses TagRFP from a CMV promoter ...
-
bioRxiv - Cell Biology 2021Quote: ... the mammalian expression vector pmKate2-mito (Evrogen plasmid #FP187) was used.
-
bioRxiv - Neuroscience 2020Quote: ... following PCR amplification from a pCMV-mito-KillerRed plasmid (Evrogen). mScarlet-i cDNA was amplified by PCR from a pmScarlet-i_C1 plasmid (gift from Dorus Gadella ...
-
bioRxiv - Developmental Biology 2022Quote: ... mKate2 was amplified from the pmKATE2-N plasmid from Evrogen introducing flanking B2 and BamHIXhoI-B3 sequences and cloned into pGEM-T Easy ...
-
bioRxiv - Microbiology 2023Quote: ... Plasmids were transformed into chemically competent XL1-Blue cells (Evrogen). Phusion DNA-Polymerase (NEB ...
-
bioRxiv - Cell Biology 2023Quote: ... Plasmid MiniPrep (BC021S) and CleanUp Standart (BC022) were from Evrogen, Russia.
-
bioRxiv - Molecular Biology 2020Quote: ... pET-NS1 was purified using a Plasmid Miniprep Kit (Evrogen, BC021). Commercial plasmid sequencing was performed using T7 primers at Evrogen (Moscow ...
-
bioRxiv - Bioengineering 2022Quote: The KR from the plasmid vector – pKillerRed-mem (Evrogen, Moscow, Russia) was cloned with a human Rhodopsin promoter ...
-
bioRxiv - Synthetic Biology 2024Quote: ... Midiprep was prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions.
-
bioRxiv - Synthetic Biology 2024Quote: ... Midipreps were prepared using the Plasmid Midiprep 2.0 kit (Evrogen, #BC124) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2021Quote: ... coli TG1 cells and purified using a Plasmid Miniprep kit (Evrogen, Russia).
-
bioRxiv - Microbiology 2021Quote: Gene encoding TurboFP650 was amplified from the plasmid pTurboFP650-N (Evrogen, Euromedex, France) with primers TurboFP650-XbaI 5’TGCTCTTAGATTTAAGAAGGAGATATAGATATGGGAGAGGATAGCGAGCTG3’ and TurboFP650-SphI 5’CATGCATGCTTAGCTGTGCCCCAGTTTGCTAGG3’ ...
-
bioRxiv - Immunology 2021Quote: Phagemid DNA was isolated from bacterial cells using the Plasmid miniprep kit (Evrogen, Russia). VHH-coding sequences were sequenced with Lac-prom (5’-CTTTATGCTTCCGGCTCGTATG-3’ ...
-
bioRxiv - Microbiology 2021Quote: ... The pG8-GFP plasmid was derived from pG8 by cloning the TagGFP2 gene (Evrogen) following the Gibson assembly protocol (NEB) ...
-
bioRxiv - Immunology 2022Quote: ... [48] fused with human IgG1 Fc-fragment and Llama IgG2b hinge were purchased from Evrogen (Russia). CHO-S cells were transfected with VHH-Fc containing construct using the CHO Gro System (Mirus Bio ...
-
bioRxiv - Molecular Biology 2020Quote: ... mIBP83 fragment of pEX-A2-SBP-T plasmid was subcloned into pTagGFP2-N vector (Evrogen) by PCR with the primers
-
bioRxiv - Immunology 2021Quote: ... The resulting NemR-cpYFP-bearing vectors were purified with the use of Plasmid Miniprep Kit (Evrogen) according to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2021Quote: ... The HeLa mKate2-EB3 cell line was generated by transfecting a pmKate2-EB3 plasmid vector (Evrogen #FP316) into HeLa cells ...
-
bioRxiv - Cell Biology 2021Quote: ... plasmid was generated by adding the C-terminal 20 amino acids of human H-Ras (NCBI Accession No. NP_005334) to a tagRFP-C vector (Evrogen) modified with a S158T point mutation to enhance photostability (Shaner et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... All code for human 4R Tau amino acids 243 to 375 containing the mutations P301L and V337M fused to GFP or FR (Evrogen) with an 18-amino acid flexible linker (EFCSRRYRGPGIHRSPTA) ...
-
bioRxiv - Cell Biology 2019Quote: ... GFP-GGA2 and myc-BioID-GGA2 constructs were generated by cloning Human GGA2 from GGA2 ORF entry vector (RC200153, origene) into following vectors using cloneEZ: pTagRFP-c (FP141, Evrogen), pTagGFP2-C (FP191 ...
-
bioRxiv - Biochemistry 2019Quote: The gene encoding the transmembrane domain of the human TrkA-TM (MK410KDETPFGVSVAVGLAVFACLFLSTLLLVLNKAGRRNK447) was amplified by PCR from six chemically synthesized oligonucleotide templates (Evrogen, Russia) whose sequences partially overlapped along its sequence ...
-
bioRxiv - Biochemistry 2021Quote: The gene encoding transmembrane and juxtamembrane residues 245-284 (MT245RGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ284) of human p75 receptor (p75-TM-wt) was amplified by PCR from six chemically synthesized oligonucleotides (Evrogen, Russia) partially overlapped along its sequence ...
-
bioRxiv - Cell Biology 2019Quote: ... and SacI/PstI for the pTag-BFP-N to obtain pLEA-BFP (all plasmid backbones were from Evrogen, Milano, Italy). Correct clones were confirmed by Sanger sequencing using ABI PRISM 3100 (Applied Biosystem).
-
bioRxiv - Microbiology 2020Quote: The plasmid expressing phoP and phoQ was constructed by cloning the PCR fragment amplified with the Tersus DNA polymerase (Evrogen) and the phoPQf1 and phoPQr primers into the low copy number vector pZH449.
-
bioRxiv - Neuroscience 2020Quote: The caldendrin-tagRFP constructs were made by amplifying full length or caldendrin fragments from the pcDNA3.1/caldendrin vector and pasting them into the tagRFP-N plasmid (Evrogen, #FP142) using EcoRI and BamHI restriction and ligation.