Labshake search
Citations for Biosynth International :
1 - 5 of 5 citations for Nipah Virus Glycoprotein F Recombinant Protein Human Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
bioRxiv - Microbiology 2019Quote: NA activities of recombinant AIV strains were measured using the fluorogenic substrate MUNANA (2’-[4-Methylumbelliferyl]-alpha-D-N-acetylneuraminic acid; Biosynth and Sigma-Aldrich), as described previously [70] ...
-
bioRxiv - Biochemistry 2023Quote: ... proteins were incubated with oligosaccharides (Forssman antigen trisaccharide: Elicityl, France; Blood group A trisaccharide: Biosynth, UK) for 5 minutes prior to their addition to the cellular samples (∼1×106 cells in 100 µL) ...
-
bioRxiv - Molecular Biology 2023Quote: ... The following antibodies were raised against the indicated peptides derived from Xenopus laevis proteins (New England Peptide now Biosynth): Dbn1 (Ac-CWDSDPVMEEEEEEEEGGGFGESA-OH) ...