Labshake search
Citations for Biosynth International :
1 - 27 of 27 citations for Collagen 17 alpha 1 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... cRGDy peptides (BioSynth Ltd.) containing the sequence cyclo-(Arg-Gly-Asp-Tyr ...
-
bioRxiv - Molecular Biology 2023Quote: ... The following antibodies were raised against the indicated peptides derived from Xenopus laevis proteins (New England Peptide now Biosynth): Dbn1 (Ac-CWDSDPVMEEEEEEEEGGGFGESA-OH) ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide and polyclonal antiserum were generated by Biosynth.
-
bioRxiv - Cancer Biology 2023Quote: ... Custom heavy isotope labeled Sulf-2 peptide (Biosynth), Trypsin/Lys-C protease (Thermo Scientific) ...
-
bioRxiv - Immunology 2024Quote: The synthetic peptide gp33–41: KAVYNFATC (LCMV- GP, H-2Db) was purchased from New England Peptide (now Biosynth; Gardner, MA, USA). PE-gp33–41 tetrameric complexes were synthesized in-house and used to detect LCMV- specific CD8 T cells (74) ...
-
bioRxiv - Biochemistry 2023Quote: Peptides were either synthesized or commercially obtained from Biosynth International Inc ...
-
bioRxiv - Immunology 2023Quote: ... refolded with a suitable peptide (VTEHDTLLY, Biosynth Gardner, MA)98 at 4°C ...
-
bioRxiv - Microbiology 2019Quote: NA activities of recombinant AIV strains were measured using the fluorogenic substrate MUNANA (2’-[4-Methylumbelliferyl]-alpha-D-N-acetylneuraminic acid; Biosynth and Sigma-Aldrich), as described previously [70] ...
-
bioRxiv - Molecular Biology 2024Quote: The 192 isoform specific peptide sequences were synthesized by Vivitide (now Biosynth, Gardner, MA, USA) with carbamidomethylation on all cysteines ...
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
bioRxiv - Biochemistry 2020Quote: ... 2 mM EGTA] containing 1 mM phenylmethanesulfonyl fluoride (PMSF) and 1% (w/v) digitonin (Biosynth) at 4°C for 50 min ...
-
bioRxiv - Immunology 2023Quote: ... and 75 µg ml−1 D-luciferin firefly (Biosynth). Cytotoxicity by engineered T-cells was determined after co-culturing peptide-pulsed K562 cells at an effector to target ratio of 1:1 ...
-
bioRxiv - Plant Biology 2023Quote: ... 20 μl of 1 mM D-luciferin (Biosynth AG) was added to each well and luminescence was visualized using the ALLIGATOR luminescence imaging system by exposing the camera for 8 minutes ...
-
bioRxiv - Synthetic Biology 2023Quote: ... isopropyl-β-D-1-thiogalactopyranoside (IPTG) was purchased from Biosynth AG (Staad ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... Protoplasts in a solution of 1 mM D-luciferin (Biosynth AG), 5 % fetal bovine serum (Sigma) ...
-
bioRxiv - Cancer Biology 2024Quote: ... cultures were pulsed with 1 mM 2’-azido-2’-deoxycytidine (Biosynth), or 0.1% DMSO for an unlabeled control ...
-
bioRxiv - Molecular Biology 2023Quote: ... 5% glycerol) supplemented with protease inhibitor cocktail containing AEBSF-HCL (1 mM, Biosynth), pepstatin (10 μM ...
-
bioRxiv - Plant Biology 2022Quote: ... average value used for mass-to-mole conversion: 2306 g.mol−1) and OG3 were purchased from Biosynth Carbosynth (https://www.carbosynth.com/ ...
-
bioRxiv - Plant Biology 2023Quote: ... 1 mg/mL X-Gluc (5-bromo-4-chloro-3-indolyl β-D-glucuronic cyclohexylammonium salt; Biosynth)] ON at 37°C ...
-
bioRxiv - Plant Biology 2019Quote: ... 0.1% triton X-100, 1 mg/ml of X-Gluc [5-bromo-4-chloro-3-indolyl-beta-D-glucuronic acid, BIOSYNTH] ...
-
bioRxiv - Cancer Biology 2023Quote: ... mice were injected intraperitoneally with 100 μL of PBS containing d-luciferin monopotassium salt (40 mg ml−1; Biosynth, L8220) and mice were anaesthetized with isoflurane 2 min before imaging ...
-
bioRxiv - Cell Biology 2024Quote: ... animals injected with luciferase vector were anesthetized with isoflurane (1% in 1L O2/min) and Luciferin substrate (Biosynth L-8220) was injected into the intraperitoneal cavity of mice at 150 mg/kg ...
-
bioRxiv - Microbiology 2024Quote: ... Cultures were then normalized to OD=1 and 20 µL was added to a black 96-well plate into containing 350 µM 4-MU-Neu5Ac (Biosynth) dissolved in 80 µL sodium acetate buffer pH 5.5 ...
-
bioRxiv - Biochemistry 2023Quote: ... 1 mM CaCl2 (pH 7.4)] supplemented with protease inhibitors (1 mM PMSF, 2 μM pepstatin A, 10 μM leupeptin) containing either 1.5% (w/v) digitonin (Biosynth D-3200) or 2% (w/v ...
-
bioRxiv - Plant Biology 2024Quote: ... staining for GUS activity for 2-5 hours at 37 °C using 1 mM of the substrate X-Gluc (5-bromo-4-chloro-3-indoxyl-b-D-GlcA, cyclohexylammonium salt, B7300; Biosynth, Staad, Switzerland) as described48 ...
-
bioRxiv - Plant Biology 2024Quote: ... and homogenized in GUS extraction buffer before 1 µg of total protein extracts were used for enzymatic reactions at 37°C using 1 mM of the 4-MUG substrate (4-Methylumbelliferyl-β-D-glucuronide hydrate, Biosynth M-5700). GUS activity was measured using a FLUOstar Omega 96 microplate reader (BMG LABTECH ...
-
bioRxiv - Plant Biology 2023Quote: Seedlings or leaves from blooming stage plants of Arabidopsis PR1::GUS line were transferred in a microtube containing 2 mL of GUS staining solution [1 mM X-Gluc (Biosynth International, Inc., San Diego CA, USA), 100 µM phosphate buffer (Fisher Scientific ...