Labshake search
Citations for Biosynth International :
1 - 9 of 9 citations for CNGA1 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2023Quote: ... cRGDy peptides (BioSynth Ltd.) containing the sequence cyclo-(Arg-Gly-Asp-Tyr ...
-
bioRxiv - Molecular Biology 2023Quote: ... The following antibodies were raised against the indicated peptides derived from Xenopus laevis proteins (New England Peptide now Biosynth): Dbn1 (Ac-CWDSDPVMEEEEEEEEGGGFGESA-OH) ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide and polyclonal antiserum were generated by Biosynth.
-
bioRxiv - Cancer Biology 2023Quote: ... Custom heavy isotope labeled Sulf-2 peptide (Biosynth), Trypsin/Lys-C protease (Thermo Scientific) ...
-
bioRxiv - Immunology 2024Quote: The synthetic peptide gp33–41: KAVYNFATC (LCMV- GP, H-2Db) was purchased from New England Peptide (now Biosynth; Gardner, MA, USA). PE-gp33–41 tetrameric complexes were synthesized in-house and used to detect LCMV- specific CD8 T cells (74) ...
-
bioRxiv - Biochemistry 2023Quote: Peptides were either synthesized or commercially obtained from Biosynth International Inc ...
-
bioRxiv - Immunology 2023Quote: ... refolded with a suitable peptide (VTEHDTLLY, Biosynth Gardner, MA)98 at 4°C ...
-
bioRxiv - Molecular Biology 2024Quote: The 192 isoform specific peptide sequences were synthesized by Vivitide (now Biosynth, Gardner, MA, USA) with carbamidomethylation on all cysteines ...
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).