Labshake search
Citations for Biosynth International :
1 - 16 of 16 citations for CKLF Like MARVEL Transmembrane Domain Containing 7 CMTM7 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... 3-azido-7-hydroxycoumarin was purchased from Biosynth International Inc ...
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
bioRxiv - Plant Biology 2020Quote: ... containing 150 μL half-strength liquid MS medium containing 0.5% sucrose and 50 μM D-luciferin-K (Biosynth, Naperville ...
-
bioRxiv - Molecular Biology 2023Quote: ... 5% glycerol) supplemented with protease inhibitor cocktail containing AEBSF-HCL (1 mM, Biosynth), pepstatin (10 μM ...
-
bioRxiv - Biochemistry 2020Quote: ... 2 mM EGTA] containing 1 mM phenylmethanesulfonyl fluoride (PMSF) and 1% (w/v) digitonin (Biosynth) at 4°C for 50 min ...
-
bioRxiv - Cancer Biology 2023Quote: ... mice were injected intraperitoneally with 100 μl of PBS containing d-luciferin monopotassium salt (40 mg/ml) (Biosynth) and mice were anaesthetized with isoflurane 2 minutes prior to imaging ...
-
bioRxiv - Microbiology 2022Quote: Logarithmic growth phase promastigotes (106) were suspended in 200 μl media containing 30 μg/ ml of luciferin (Biosynth AG) and added to a 96-well plate (Black plate ...
-
bioRxiv - Cancer Biology 2023Quote: ... mice were injected intraperitoneally with 100 μL of PBS containing d-luciferin monopotassium salt (40 mg ml−1; Biosynth, L8220) and mice were anaesthetized with isoflurane 2 min before imaging ...
-
bioRxiv - Plant Biology 2024Quote: ... root samples were incubated overnight in the dark at 28 °C in Z-buffer containing 2 mM Magenta-Gal (5-bromo-6-chloro-3-indoxyl-b-D-galactopyranoside; B7200; Biosynth) or X-Gal (5-bromo-4-chloro-3-indolyl-b-D-galactopyranoside ...
-
bioRxiv - Microbiology 2024Quote: ... Cultures were then normalized to OD=1 and 20 µL was added to a black 96-well plate into containing 350 µM 4-MU-Neu5Ac (Biosynth) dissolved in 80 µL sodium acetate buffer pH 5.5 ...
-
bioRxiv - Cell Biology 2019Quote: ... each containing standard RPMI 1640 medium with 10% fetal bovine serum and 0.1 mM D-luciferin (L-8220, Biosynth, Itaska, IL). The islets were placed in the Luminoview LV200 Bioluminescence Imaging System and bioluminescence was measured for 1 min at intervals of 10 min and continuously recorded for at least 3 days ...
-
bioRxiv - Biochemistry 2023Quote: ... 1 mM CaCl2 (pH 7.4)] supplemented with protease inhibitors (1 mM PMSF, 2 μM pepstatin A, 10 μM leupeptin) containing either 1.5% (w/v) digitonin (Biosynth D-3200) or 2% (w/v ...
-
bioRxiv - Microbiology 2021Quote: ... 20 µL of cell culture supernatant of each sample and 100 µL of assay buffer containing 4 µM coelenterazine native (Biosynth Carbosynth, Cat. No. C-7001) were added to one well of a 96-well black opaque assay plate (Corning ...
-
bioRxiv - Microbiology 2023Quote: ... 20 μL of cell culture supernatant of each sample and 100 μL of assay buffer containing 4 μM coelenterazine native (Biosynth Carbosynth, Cat. No. C-7001) were added to one well of a 96-well black opaque assay plate (Corning ...
-
bioRxiv - Plant Biology 2023Quote: Seedlings or leaves from blooming stage plants of Arabidopsis PR1::GUS line were transferred in a microtube containing 2 mL of GUS staining solution [1 mM X-Gluc (Biosynth International, Inc., San Diego CA, USA), 100 µM phosphate buffer (Fisher Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... The following antibodies were raised against the indicated peptides derived from Xenopus laevis proteins (New England Peptide now Biosynth): Dbn1 (Ac-CWDSDPVMEEEEEEEEGGGFGESA-OH) ...