Labshake search
Citations for Biosynth International :
1 - 34 of 34 citations for 6H 1 3 5 Trioxepino 6 7 f benzimidazole 9CI since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... 3-azido-7-hydroxycoumarin was purchased from Biosynth International Inc ...
-
bioRxiv - Plant Biology 2024Quote: ... root samples were incubated overnight in the dark at 28 °C in Z-buffer containing 2 mM Magenta-Gal (5-bromo-6-chloro-3-indoxyl-b-D-galactopyranoside; B7200; Biosynth) or X-Gal (5-bromo-4-chloro-3-indolyl-b-D-galactopyranoside ...
-
bioRxiv - Plant Biology 2023Quote: ... 1 mg/mL X-Gluc (5-bromo-4-chloro-3-indolyl β-D-glucuronic cyclohexylammonium salt; Biosynth)] ON at 37°C ...
-
bioRxiv - Plant Biology 2019Quote: ... 0.1% triton X-100, 1 mg/ml of X-Gluc [5-bromo-4-chloro-3-indolyl-beta-D-glucuronic acid, BIOSYNTH] ...
-
bioRxiv - Plant Biology 2024Quote: ... staining for GUS activity for 2-5 hours at 37 °C using 1 mM of the substrate X-Gluc (5-bromo-4-chloro-3-indoxyl-b-D-GlcA, cyclohexylammonium salt, B7300; Biosynth, Staad, Switzerland) as described48 ...
-
bioRxiv - Genetics 2022Quote: ... 2 mM X-Gluc (5-bromo-4-chloro-3-indolyl-ß-D-glucuronic acid; Biosynth), dissolved in N,N-dimethylformamide) ...
-
bioRxiv - Plant Biology 2023Quote: Histochemical GUS assay was performed as described by Jefferson et al (1987) using the chromogenic substrate XGluc (5-bromo-4-chloro-3-indolylglucuronide) (Biosynth). Tissue was incubated in GUS staining solution ...
-
bioRxiv - Plant Biology 2020Quote: ... 5 mM ferricyanide and 20mg/ml 5 -bromo-4-chloro-3-indolyl-beta-d-glucuronic acid cyclohexyl-ammonium salt (X-gluc, Biosynth AG, Staad, CH) in 50 mM phosphate buffer) ...
-
bioRxiv - Molecular Biology 2023Quote: ... 5% glycerol) supplemented with protease inhibitor cocktail containing AEBSF-HCL (1 mM, Biosynth), pepstatin (10 μM ...
-
bioRxiv - Microbiology 2023Quote: ... Indole-3-aldehyde (I3A) and indole-3-pyruvate (IPyA) were obtained from Biosynth. Tryptophol (IEt) ...
-
bioRxiv - Biophysics 2021Quote: 4’,6-Diamidino-2-phenylindole 2HCl (purchased from Biosynth Carbosynth ...
-
bioRxiv - Biochemistry 2023Quote: ... 4-Methylumbelliferyl N-acetyl-β-D-glucosaminide-6-phosphorylcholine (4MU-ý-GlcNAc-6-PC) and 4-Methylumbelliferyl phosphorylcholine (4MU-PC) were from Biosynth (Staad, Switzerland). 4-Methylumbelliferyl N-acetyl-β-D-glucosaminide (4MU-ý-GlcNAc ...
-
bioRxiv - Cell Biology 2023Quote: ... cells were also incubated in 5 µM 5-ethynyl-2′-deoxyuridine (EdU, NE08701, Biosynth) for 48 hours to incorporate this thymidine analogue in any cell undergoing DNA synthesis within the treatment period.
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant IL-6 with an N-terminal his tag (Fitzgerald, Biosynth Ltd.) was immobilized on His-Pur™ Ni-NTA Resin (ThermoScientific ...
-
bioRxiv - Biochemistry 2023Quote: ... domain of LayV F (LayV HR2, KIDIGNQLAGINQTLQNAEDYIEKSEEFLKGINPSI) and the corresponding scrambled peptide (scrambled LayV HR2, SIANIQEKDIIKLETEDPEIYAGNKLGSQILNFGQN) were synthesized by Biosynth (Gardner, MA, USA).
-
bioRxiv - Plant Biology 2023Quote: ... Arabidopsis seedlings were sprayed with 3 mM D-luciferin (Biosynth) prepared in 0.01% (v/v ...
-
Metabolomics reveals nucleoside analogs for regulating mucosal-associated invariant T cell responsesbioRxiv - Immunology 2023Quote: ... The 2-deoxy-5-formyluridine (M=256.070, Cat# ND29039 from Biosynth Carbosynth) was initially dissolved in DMSO at 25.6 ug/ul or 100 mM ...
-
bioRxiv - Physiology 2022Quote: ... Plant tissue or xylem sap were derivatized using an NMR-purified fluorescing reagent AQC (6-aminoQuinolyl-N hydroxysuccinimidyl carbamate) (BIOSYNTH AG, Switzerland). Three mg of AQC were dissolved in 1 ml acetonitrile and incubated for 10 min at 55°C ...
-
bioRxiv - Cancer Biology 2019Quote: ... with 100 μl of the D-Luciferin solution at a final dose of 3 mg/20 g mouse body weight (Biosynth, Cat. No. L-82220) and then gas-anaesthetized with isoflurane (Faulding Pharmaceuticals) ...
-
bioRxiv - Neuroscience 2022Quote: ... On Day 3, mice were pretreated with either saline (10 ml/kg, i.p.) or pregabalin (30 mg/kg, i.p., Biosynth Carbosynth, San Diego, CA; Cat#FA27139), a dose previously shown to attenuate cocaine intravenous self-administration (de Guglielmo et al. ...
-
bioRxiv - Cell Biology 2021Quote: ... After application of a white sticker to the bottom of the 96-well tray and addition of 10 μl of a 5x coelenterazine H solution (Biosynth, 3 μM final concentration in the assay) to all wells ...
-
bioRxiv - Biochemistry 2020Quote: ... 2 mM EGTA] containing 1 mM phenylmethanesulfonyl fluoride (PMSF) and 1% (w/v) digitonin (Biosynth) at 4°C for 50 min ...
-
bioRxiv - Immunology 2023Quote: ... and 75 µg ml−1 D-luciferin firefly (Biosynth). Cytotoxicity by engineered T-cells was determined after co-culturing peptide-pulsed K562 cells at an effector to target ratio of 1:1 ...
-
bioRxiv - Plant Biology 2023Quote: ... 20 μl of 1 mM D-luciferin (Biosynth AG) was added to each well and luminescence was visualized using the ALLIGATOR luminescence imaging system by exposing the camera for 8 minutes ...
-
bioRxiv - Synthetic Biology 2023Quote: ... isopropyl-β-D-1-thiogalactopyranoside (IPTG) was purchased from Biosynth AG (Staad ...
-
bioRxiv - Evolutionary Biology 2019Quote: ... Protoplasts in a solution of 1 mM D-luciferin (Biosynth AG), 5 % fetal bovine serum (Sigma) ...
-
bioRxiv - Cancer Biology 2024Quote: ... cultures were pulsed with 1 mM 2’-azido-2’-deoxycytidine (Biosynth), or 0.1% DMSO for an unlabeled control ...
-
bioRxiv - Plant Biology 2022Quote: ... average value used for mass-to-mole conversion: 2306 g.mol−1) and OG3 were purchased from Biosynth Carbosynth (https://www.carbosynth.com/ ...
-
bioRxiv - Cancer Biology 2023Quote: ... mice were injected intraperitoneally with 100 μL of PBS containing d-luciferin monopotassium salt (40 mg ml−1; Biosynth, L8220) and mice were anaesthetized with isoflurane 2 min before imaging ...
-
bioRxiv - Microbiology 2024Quote: ... Cultures were then normalized to OD=1 and 20 µL was added to a black 96-well plate into containing 350 µM 4-MU-Neu5Ac (Biosynth) dissolved in 80 µL sodium acetate buffer pH 5.5 ...
-
bioRxiv - Cell Biology 2024Quote: ... animals injected with luciferase vector were anesthetized with isoflurane (1% in 1L O2/min) and Luciferin substrate (Biosynth L-8220) was injected into the intraperitoneal cavity of mice at 150 mg/kg ...
-
bioRxiv - Biochemistry 2023Quote: ... 1 mM CaCl2 (pH 7.4)] supplemented with protease inhibitors (1 mM PMSF, 2 μM pepstatin A, 10 μM leupeptin) containing either 1.5% (w/v) digitonin (Biosynth D-3200) or 2% (w/v ...
-
bioRxiv - Plant Biology 2024Quote: ... and homogenized in GUS extraction buffer before 1 µg of total protein extracts were used for enzymatic reactions at 37°C using 1 mM of the 4-MUG substrate (4-Methylumbelliferyl-β-D-glucuronide hydrate, Biosynth M-5700). GUS activity was measured using a FLUOstar Omega 96 microplate reader (BMG LABTECH ...
-
bioRxiv - Plant Biology 2023Quote: Seedlings or leaves from blooming stage plants of Arabidopsis PR1::GUS line were transferred in a microtube containing 2 mL of GUS staining solution [1 mM X-Gluc (Biosynth International, Inc., San Diego CA, USA), 100 µM phosphate buffer (Fisher Scientific ...