Labshake search
Citations for Biomatik Corporation :
1 - 35 of 35 citations for WD Repeat Containing Planar Cell Polarity Effector WDPCP Antibody Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2021Quote: ... The sequence encoding 7x repeats of a PRM from lamellipodin (aa 970-981) containing (Gly-Gly-Ser)4 linkers was custom synthesized by Biomatik Corporation (Canada) ...
-
bioRxiv - Immunology 2020Quote: ... biotinylated (NANP)9 repeat region of Pf CSP was sourced from Biomatik (Ontario, Canada). Biotinylated antigens were incubated with premium−grade SA−PE and SA−APC (Molecular Probes ...
-
bioRxiv - Cell Biology 2024Quote: CTD peptides with double repeats were labeled with fluorescein isothiocyanate (FITC) and purchased from Biomatik. Protein and peptide concentrations were determined according to their absorbance at 280 nm ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Biochemistry 2020Quote: ... 998 bp inserts containing site-directed mutations were generated via DNA synthesis (Biomatik), flanked with BamHI/PciI restriction sites and 6 base pair (bp ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Human FYCO1 peptide (amino acids 1265– 1298, containing the LIR and adjacent residues) [4] was synthesized by Biomatik and reconstituted at 2 mg/ml in DMSO ...
-
bioRxiv - Cell Biology 2021Quote: The cloning vector pBSK(+) containing the cDNA encoding human CBS isoform 1 was synthesised and purchase from Biomatik company (Biomatik Cooperation ...
-
bioRxiv - Genomics 2022Quote: ... or 6 along with its flanking intron regions containing appropriate restriction enzyme sites was synthesized (Biomatik or Genewiz). Each exon of mouse Asmt gene in pcDNA5-FRT-TO was replaced with the human form using the appropriate restriction enzymes ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
bioRxiv - Molecular Biology 2021Quote: ... pUC57-based plasmids containing either the blasticidin or the phleomycin resistance cassettes were designed and ordered from Biomatik (S2 Fig). Actin UTR 5’ and 3’ UTRs flank the resistance cassettes ...
-
bioRxiv - Plant Biology 2024Quote: ... A DNA fragment containing these elements (MEter:Cry1CM-intron::S7S7-S4S4::Cry1BM::E9ter) was then synthesized to our specifications by Biomatik (www.biomatik.com) and cloned in the EcoRI/HindIII sites of the pUC19 vector ...
-
bioRxiv - Microbiology 2024Quote: ... A plasmid library containing an R4 attB site and a stretch of 20 random nucleotides was synthesized (Biomatik, Ontario, Canada). The resulting barcode library was integrated into the R4 attB site of otherwise wild-type strains ...
-
bioRxiv - Biochemistry 2023Quote: ... 100 μM substrate was incubated for 90 minutes at room temperature with 20 mM recombinant SortA enzyme and 500 μM FAM-containing peptide (5-carboxyfluorescein-HHHHHHLPETGG, Biomatik) in GF buffer supplemented with 1 mM DTT and 10 mM CaCl2 ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Neuroscience 2024Quote: Antibodies recognizing the NRG1 intracellular domain were raised in rabbits using the immunizing peptide: DEE(pY)ETTQEYEPAQEP by Biomatik. Antibodies recognizing the phosphorylated peptide DEE(pY)ETTQEYEPAQEP vs ...
-
bioRxiv - Cell Biology 2024Quote: ... cells were treated with 0.25 mg/mL RNase A (Biomatik) at 50°C for 1 hour and 0.125 mg/mL Proteinase K (Biomatik ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Neuroscience 2020Quote: ... specifically designed for detection of Cx43 in human cells (BioMatik, EKU03444). In short ...
-
bioRxiv - Molecular Biology 2023Quote: Cell permeable Scrambled (Ctrl) and FBP1 peptides were synthesized by Biomatik. Male BL6 mice were HFD fed for 14 weeks from week 7 postnatally ...
-
bioRxiv - Plant Biology 2020Quote: ... The binding of NCR044.1 to the phospholipids on the strips was detected using a polyclonal antibody generated in rabbits with custom-synthesized NCR044.1 (Biomatik Corp., Cambridge, ON, CDN). Binding of NCR044.1 to PI4P and PI(3,5)P2 was determined using the PolyPIPosomes (Echelon Biosciences ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YP-Raf supplemented with α-factor (Biomatik) to a final concentration of 25 nM ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YPD supplemented with 5 µg/ml α-factor (Biomatik) and auxin to a final concentration of 500 µM ...
-
bioRxiv - Cell Biology 2023Quote: ... Urinary levels of low-molecular weight Clara cell protein (CC16) were measured by using an enzyme-linked immunosorbent assay in according to the manufacturer’s instructions (BIOMATIK EKU03200 ...
-
bioRxiv - Cancer Biology 2021Quote: ... cells were incubated with 0.5 mg/mL MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE USA) in PBS for 3 h ...
-
bioRxiv - Microbiology 2023Quote: ... PrV-mScarlet-UL25-ΔUS3 was generated similarly by homologous recombination through transfecting PK15 cells with phenol-chloroform extracted PrV DNA strain Kaplan ΔUS354 but using a synthetic DNA construct (Biomatik, Canada) employing longer homologous sequences of 399 bp upstream and 573 bp downstream ...
-
bioRxiv - Cancer Biology 2024Quote: ... cells were incubated with 0.5 mg/ml MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE, United States) in PBS at 37°C for 1 h ...