Labshake search
Citations for Biomatik Corporation :
1 - 33 of 33 citations for Tumor Necrosis Factor Alpha Induced Protein 2 TNFAIP2 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: Arthritis was induced by the hGPIc-c peptide (NH2-IWYINCFGCETHAML-OH; Biomatik) emulsified with an equal volume of complete Freund’s adjuvant ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YP-Raf supplemented with α-factor (Biomatik) to a final concentration of 25 nM ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YPD supplemented with 5 µg/ml α-factor (Biomatik) and auxin to a final concentration of 500 µM ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Systems Biology 2021Quote: ... genes encoding for these proteins were synthesised by commercial gene synthesis services (Biomatik). Target genes were sub-cloned into the cell-free expression vector pEUE01-His-N2 (CellFree Sciences ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
Folding of VemP into translation-arresting secondary structure is driven by the ribosome exit tunnelbioRxiv - Biophysics 2021Quote: The VemP constructs (VemP-1, VemP-2, and VemP-3) were synthesized by Biomatik using solid state synthesis at a 95% purity level ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Cell Biology 2022Quote: ... The Miro1 protein level in each sample collected was determined using the RHOT1 ELISA Kit 96T (EKL54911, Biomatik) according to the manufacturer’s manual ...
-
bioRxiv - Neuroscience 2022Quote: ... we purchased MIF-1 from Cayman Chemical (Catalog #24476) and had OT 2-9 and OT 4-9 synthesized by Biomatik (Ontario, Canada). Since oxytocin is cyclic ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Physiology 2019Quote: ... C-reactive protein (CRP) levels were measured using a human high-sensitivity CRP (hs-CRP) ELISA kit (Biomatik, Canada) as per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Urinary levels of low-molecular weight Clara cell protein (CC16) were measured by using an enzyme-linked immunosorbent assay in according to the manufacturer’s instructions (BIOMATIK EKU03200 ...
-
bioRxiv - Neuroscience 2022Quote: ... Dmt = 2’,6’-dimethylthyrosine) and SS20 (Phe-D-Arg-Phe-Lys-NH2) were obtained from Biomatik (https://www.biomatik.com). SS31 and SS20 were administered intraperitoneally to APP/PS1 Tg and non-transgenic littermate mice (5mg/kg body weight ...
-
bioRxiv - Biochemistry 2023Quote: ... Beads were washed four times with ice-cold lysis buffer and proteins were eluted by adding 150 µg of 3xFlag peptide (Biomatik, 56305) competitor and gently rocking for 30 minutes at room temperature ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A comprehensive library of human protein domains that potentially read methyllysine marks was cloned into a pGEX vector by Biomatik (Cambridge, Canada) using gene synthesis to best optimize the open reading frames for bacterial expression ...
-
bioRxiv - Neuroscience 2023Quote: ... Depletion of p11 from the media was confirmed using Rat S100 Calcium Binding Protein A10 (S100A10) ELISA Kit (Biomatik, Cat# EKN48271-96T) as per the attached instructions.
-
bioRxiv - Biophysics 2022Quote: The synthetic gene for the SARS-CoV-2 NCTD (residues 256 to 364) cloned into the vector pET28a(+) was provided by Biomatik. The insert is in frame with the N-terminal His6-tag ...
-
bioRxiv - Microbiology 2022Quote: ... by 2 h incubation with sortase A (∼1:30 molar ratio) and a 2-fold molar excess of a Gly-Gly-Asn-Lys-(fluorescein-isothiocyanate) peptide (Biomatik) in PBS Buffer (10 mM Na2HPO4 ...
-
bioRxiv - Cancer Biology 2021Quote: ... cells were incubated with 0.5 mg/mL MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE USA) in PBS for 3 h ...
-
bioRxiv - Biophysics 2024Quote: ... They were spawned during the spawning season (April to July) by injecting 5 ml of 2 nM NGLWYamide spawning peptide [82] (synthesized by Biomatik) at the anterior and posterior ends of the gonad ...
-
bioRxiv - Cancer Biology 2024Quote: ... cells were incubated with 0.5 mg/ml MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE, United States) in PBS at 37°C for 1 h ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Neuroscience 2024Quote: Antibodies recognizing the NRG1 intracellular domain were raised in rabbits using the immunizing peptide: DEE(pY)ETTQEYEPAQEP by Biomatik. Antibodies recognizing the phosphorylated peptide DEE(pY)ETTQEYEPAQEP vs ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Plant Biology 2020Quote: ... The binding of NCR044.1 to the phospholipids on the strips was detected using a polyclonal antibody generated in rabbits with custom-synthesized NCR044.1 (Biomatik Corp., Cambridge, ON, CDN). Binding of NCR044.1 to PI4P and PI(3,5)P2 was determined using the PolyPIPosomes (Echelon Biosciences ...