Labshake search
Citations for Biomatik Corporation :
1 - 29 of 29 citations for Tonsoku Like DNA Repair Protein TONSL Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2023Quote: ... PrV-mScarlet-UL25-ΔUS3 was generated similarly by homologous recombination through transfecting PK15 cells with phenol-chloroform extracted PrV DNA strain Kaplan ΔUS354 but using a synthetic DNA construct (Biomatik, Canada) employing longer homologous sequences of 399 bp upstream and 573 bp downstream ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Systems Biology 2021Quote: ... genes encoding for these proteins were synthesised by commercial gene synthesis services (Biomatik). Target genes were sub-cloned into the cell-free expression vector pEUE01-His-N2 (CellFree Sciences ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Biochemistry 2022Quote: ... The DHR2 domain of human DOCK11 DNA (NM_144658.3) was synthesized by BioMatik (USA). The human DOCK7 DNA (NM_033407.2 ...
-
bioRxiv - Biochemistry 2020Quote: ... 998 bp inserts containing site-directed mutations were generated via DNA synthesis (Biomatik), flanked with BamHI/PciI restriction sites and 6 base pair (bp ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Genetics 2021Quote: ... we used a plasmid DNA template as described in [48] (synthesised by Biomatik, Kitchener, Ontario, Canada). For the T440del mutation ...
-
bioRxiv - Cell Biology 2022Quote: ... The Miro1 protein level in each sample collected was determined using the RHOT1 ELISA Kit 96T (EKL54911, Biomatik) according to the manufacturer’s manual ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Neuroscience 2020Quote: ... ssFLAG-Nrh1C191-dGFP-v2a-mCherry and ssFLAG-A2C-dGFP-v2a-mCherry DNA sequences were produced by Biomatik (complete DNA sequences are provided in text file S1) ...
-
bioRxiv - Physiology 2019Quote: ... C-reactive protein (CRP) levels were measured using a human high-sensitivity CRP (hs-CRP) ELISA kit (Biomatik, Canada) as per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Urinary levels of low-molecular weight Clara cell protein (CC16) were measured by using an enzyme-linked immunosorbent assay in according to the manufacturer’s instructions (BIOMATIK EKU03200 ...
-
bioRxiv - Biochemistry 2023Quote: ... Beads were washed four times with ice-cold lysis buffer and proteins were eluted by adding 150 µg of 3xFlag peptide (Biomatik, 56305) competitor and gently rocking for 30 minutes at room temperature ...
-
bioRxiv - Plant Biology 2024Quote: ... A DNA fragment containing these elements (MEter:Cry1CM-intron::S7S7-S4S4::Cry1BM::E9ter) was then synthesized to our specifications by Biomatik (www.biomatik.com) and cloned in the EcoRI/HindIII sites of the pUC19 vector ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A comprehensive library of human protein domains that potentially read methyllysine marks was cloned into a pGEX vector by Biomatik (Cambridge, Canada) using gene synthesis to best optimize the open reading frames for bacterial expression ...
-
bioRxiv - Neuroscience 2023Quote: ... Depletion of p11 from the media was confirmed using Rat S100 Calcium Binding Protein A10 (S100A10) ELISA Kit (Biomatik, Cat# EKN48271-96T) as per the attached instructions.
-
bioRxiv - Microbiology 2023Quote: ... and the PB2 from A/Anhui/1/2013/H7N3 (GenBank accession number CY181528.1) were commercially synthesized as full-length DNA copies (Biomatik GmbH, Rodgau, Germany) and supplied as plasmid clones ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Neuroscience 2024Quote: Antibodies recognizing the NRG1 intracellular domain were raised in rabbits using the immunizing peptide: DEE(pY)ETTQEYEPAQEP by Biomatik. Antibodies recognizing the phosphorylated peptide DEE(pY)ETTQEYEPAQEP vs ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Plant Biology 2020Quote: ... The binding of NCR044.1 to the phospholipids on the strips was detected using a polyclonal antibody generated in rabbits with custom-synthesized NCR044.1 (Biomatik Corp., Cambridge, ON, CDN). Binding of NCR044.1 to PI4P and PI(3,5)P2 was determined using the PolyPIPosomes (Echelon Biosciences ...