Labshake search
Citations for Biomatik Corporation :
1 - 35 of 35 citations for Mouse Marginal Zone B And B1 Cell Specific Protein MZB1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2020Quote: ... and the TNF-α mouse ELISA kit (Biomatik, EKA51917), respectively ...
-
bioRxiv - Genetics 2023Quote: ... An equine specific COL3A1 ELISA (EKU11662, Biomatik, Delaware, USA) was subsequently used to measure the amount of COL3A1 in 300 ng of total whole cell extract ...
-
bioRxiv - Neuroscience 2024Quote: ... The Serpina3n concentration was determined using the mouse Serpina3n ELISA kit (BIOMATIK, EKF58884). ELISA was performed according to the manufacturer’s instruction.
-
bioRxiv - Physiology 2020Quote: ... and Substance P ELISA (mouse, Biomatik #EKC37868) kit ...
-
bioRxiv - Immunology 2023Quote: Detection of NRG1 levels was performed using mouse NRG1 ELISA kit (cat# EKN47308, Biomatik, Delaware USA) following manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: ... The Miro1 protein level in each sample collected was determined using the RHOT1 ELISA Kit 96T (EKL54911, Biomatik) according to the manufacturer’s manual ...
-
bioRxiv - Physiology 2019Quote: ... C-reactive protein (CRP) levels were measured using a human high-sensitivity CRP (hs-CRP) ELISA kit (Biomatik, Canada) as per the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2020Quote: ... Levels of leptin and TNF-α were determined in undiluted samples using the Leptin mouse ELISA kit (Biomatik, EKB01861) and the TNF-α mouse ELISA kit (Biomatik ...
-
bioRxiv - Biochemistry 2020Quote: ... Levels of adiponectin in the CM were determined after a 1:1000 dilution using the adiponectin mouse ELISA kit (Biomatik, EKL54022). Levels of IL-6 were measured after a 1:2 CM dilution using the IL-6 mouse ELISA kit (Thermo-Fisher ...
-
bioRxiv - Neuroscience 2023Quote: ... Depletion of p11 from the media was confirmed using Rat S100 Calcium Binding Protein A10 (S100A10) ELISA Kit (Biomatik, Cat# EKN48271-96T) as per the attached instructions.
-
bioRxiv - Microbiology 2021Quote: ... and DDimer and Fibrinogen were quantified using Biomatik ELISA kits (Biomatik Corporation, Ontario, Canada).
-
bioRxiv - Microbiology 2021Quote: ... The levels of lipopolysaccharides (LPS) were also measured by ELISA kit (#EKC34448, Biomatik, Wilmington, DE) following the manufacturer’s instruction manual ...
-
bioRxiv - Cell Biology 2020Quote: ... The concentration of netrin-1 in the concentrated conditioned media was measured using the ELISA development kit (EKC37454, Biomatik), also according to the manufacturer’s instructions.
-
bioRxiv - Microbiology 2021Quote: ... Levels of occludin were measured by ELISA (Biomatik). Plasma levels of Reg3A were measured by ELISA (RayBiotech) ...
-
bioRxiv - Immunology 2019Quote: Human sera from 6 DENV confirmed patients and 31 healthy donors were diluted 1:10 and assayed with the Human MHCE/HLA-E ELISA Kit (Biomatik) per manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2020Quote: ... or VEGF-B (1nM, Cat#RPU44324, Biomatik) for 30 min before recording ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Microbiology 2023Quote: ... Secretin was similarly measured using an ELISA (Biomatik, USA, EKU07226). For pig tissue ...
-
bioRxiv - Bioengineering 2022Quote: ... FITC labeled KFFIIK and Rhodamine-B labeled EFFIIE peptides (Biomatik Corporation) were used ...
-
bioRxiv - Bioengineering 2020Quote: AMCC CAT concentrations before and after PACAP stimuli were quantified using an EP and NEP ELISA (Biomatik). Cell culture media was collected from a minimum of three AMCC cultures from two independent experiments for each group tested ...
-
bioRxiv - Cell Biology 2023Quote: ... Urinary levels of low-molecular weight Clara cell protein (CC16) were measured by using an enzyme-linked immunosorbent assay in according to the manufacturer’s instructions (BIOMATIK EKU03200 ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Neuroscience 2021Quote: Peptides P1 and P2 from mouse NMDAR1 were synthesized by Biomatik. The P1 (KLVQVGIYNGTHVIPNDRKI ...
-
bioRxiv - Systems Biology 2021Quote: ... genes encoding for these proteins were synthesised by commercial gene synthesis services (Biomatik). Target genes were sub-cloned into the cell-free expression vector pEUE01-His-N2 (CellFree Sciences ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Biochemistry 2023Quote: ... Beads were washed four times with ice-cold lysis buffer and proteins were eluted by adding 150 µg of 3xFlag peptide (Biomatik, 56305) competitor and gently rocking for 30 minutes at room temperature ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A comprehensive library of human protein domains that potentially read methyllysine marks was cloned into a pGEX vector by Biomatik (Cambridge, Canada) using gene synthesis to best optimize the open reading frames for bacterial expression ...
-
bioRxiv - Cell Biology 2024Quote: ... cells were treated with 0.25 mg/mL RNase A (Biomatik) at 50°C for 1 hour and 0.125 mg/mL Proteinase K (Biomatik ...
-
bioRxiv - Neuroscience 2020Quote: ... specifically designed for detection of Cx43 in human cells (BioMatik, EKU03444). In short ...
-
bioRxiv - Molecular Biology 2023Quote: Cell permeable Scrambled (Ctrl) and FBP1 peptides were synthesized by Biomatik. Male BL6 mice were HFD fed for 14 weeks from week 7 postnatally ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YP-Raf supplemented with α-factor (Biomatik) to a final concentration of 25 nM ...
-
bioRxiv - Cell Biology 2020Quote: ... cultures were vacuum-filtered and cells were resuspended in fresh YPD supplemented with 5 µg/ml α-factor (Biomatik) and auxin to a final concentration of 500 µM ...
-
bioRxiv - Cancer Biology 2021Quote: ... cells were incubated with 0.5 mg/mL MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE USA) in PBS for 3 h ...
-
bioRxiv - Microbiology 2023Quote: ... PrV-mScarlet-UL25-ΔUS3 was generated similarly by homologous recombination through transfecting PK15 cells with phenol-chloroform extracted PrV DNA strain Kaplan ΔUS354 but using a synthetic DNA construct (Biomatik, Canada) employing longer homologous sequences of 399 bp upstream and 573 bp downstream ...
-
bioRxiv - Cancer Biology 2024Quote: ... cells were incubated with 0.5 mg/ml MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) (Biomatik, Wilmington, DE, United States) in PBS at 37°C for 1 h ...