Labshake search
Citations for Biomatik Corporation :
1 - 44 of 44 citations for MEK Kinase Kinase 1 MAP4K1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... psi ε receptor for activated C kinase (ψεRACK) (27) was purchased from Biomatik (Wilmington, DE, USA), and the proinflammatory cytokine prostaglandin-E2 (PGE2 ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Cell Biology 2020Quote: ... anti-Cit150 (Biomatik, 1:4000), anti-β-actin (Abcam ab8224 ...
-
bioRxiv - Molecular Biology 2022Quote: ... anti-mLIMCH1 (1:200, Biomatik), anti-RYR1 (1:200 ...
-
bioRxiv - Cell Biology 2019Quote: ... rabbit IgG (Cocalico Biologicals, 1 mg/ml, diluted 1:1000); 4) anti-3A (KDLKIDIKTSPPPEC; (Richards et al., 2014)) rabbit IgG (Biomatik, 0.6 mg/ml, diluted 1:500). Protein derived from extracellular vesicles (20 µg per lane ...
-
bioRxiv - Molecular Biology 2022Quote: ... and anti-mLIMCH1 (1:400, Biomatik). Membranes were washed three times with PBS-T and incubated for one hour at room temperature in HRP-conjugated goat anti–rabbit or goat anti-mouse secondary antibody (1:10,000 ...
-
bioRxiv - Biochemistry 2022Quote: ... and Cit1 (73) (Biomatik, 1:4000). Fluorescent conjugated secondary antibodies included α-mouse 800 (LICOR ...
-
bioRxiv - Neuroscience 2023Quote: ... rabbit anti-GABRB3 (Biomatik, 1:500),22 rabbit anti-MeCP2 (Michael Greenberg ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Neuroscience 2024Quote: Antibodies recognizing the NRG1 intracellular domain were raised in rabbits using the immunizing peptide: DEE(pY)ETTQEYEPAQEP by Biomatik. Antibodies recognizing the phosphorylated peptide DEE(pY)ETTQEYEPAQEP vs ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Developmental Biology 2020Quote: ... Psi (Rabbit 1 in 500 custom-made via Biomatik) Lamin (Mouse ...
-
bioRxiv - Genetics 2019Quote: ... and H3(1-44)K4me3K36me3 peptides were ordered from Biomatik. Binding experiments were performed with protein in the sample cell and peptides were injected into the cell with a syringe ...
-
bioRxiv - Immunology 2021Quote: ... Splenocytes were incubated with 1 μg/ml SIINFEKL peptide (Biomatik) at 37°C for 30 minutes ...
-
bioRxiv - Cell Biology 2021Quote: ... We utilized 1 mM phosphoserine peptide generated by (Biomatik, (Canada)) with the sequence ...
-
bioRxiv - Cell Biology 2019Quote: ... rabbit anti-BUB1-p609 (custom raised by Biomatik, 1:1000), rabbit anti-BUBR1-p620 (custom raised by Moravian ...
-
bioRxiv - Biochemistry 2023Quote: ... All other Tax-1-derived peptides were synthesized by Biomatik, Canada ...
-
bioRxiv - Plant Biology 2020Quote: ... The binding of NCR044.1 to the phospholipids on the strips was detected using a polyclonal antibody generated in rabbits with custom-synthesized NCR044.1 (Biomatik Corp., Cambridge, ON, CDN). Binding of NCR044.1 to PI4P and PI(3,5)P2 was determined using the PolyPIPosomes (Echelon Biosciences ...
-
bioRxiv - Immunology 2024Quote: ... 200 μg of human IRBP-p (peptide 1-20) (Biomatik, Wilmington, DE) was emulsified in Complete Freund’s Adjuvant (1:1 w/v ...
-
bioRxiv - Biochemistry 2022Quote: The Tax-1 10-mer (H-SEKHFRETEV-OH) peptide was synthesized by Biomatik, Canada ...
-
bioRxiv - Cell Biology 2024Quote: ... at 50°C for 1 hour and 0.125 mg/mL Proteinase K (Biomatik) for an additional hour at 50°C ...
-
Folding of VemP into translation-arresting secondary structure is driven by the ribosome exit tunnelbioRxiv - Biophysics 2021Quote: The VemP constructs (VemP-1, VemP-2, and VemP-3) were synthesized by Biomatik using solid state synthesis at a 95% purity level ...
-
bioRxiv - Biochemistry 2023Quote: ... and MLL5 (Uniprot #Q8IZD2; residues 100-180) were synthesized in a pGEX-4T-1 vector (BioMatik Corporation) and provided by Dr ...
-
bioRxiv - Cell Biology 2021Quote: The cloning vector pBSK(+) containing the cDNA encoding human CBS isoform 1 was synthesised and purchase from Biomatik company (Biomatik Cooperation ...
-
bioRxiv - Cell Biology 2020Quote: ... The concentration of netrin-1 in the concentrated conditioned media was measured using the ELISA development kit (EKC37454, Biomatik), also according to the manufacturer’s instructions.
-
bioRxiv - Immunology 2019Quote: Human sera from 6 DENV confirmed patients and 31 healthy donors were diluted 1:10 and assayed with the Human MHCE/HLA-E ELISA Kit (Biomatik) per manufacturer’s instructions ...
-
bioRxiv - Microbiology 2022Quote: ... by 2 h incubation with sortase A (∼1:30 molar ratio) and a 2-fold molar excess of a Gly-Gly-Asn-Lys-(fluorescein-isothiocyanate) peptide (Biomatik) in PBS Buffer (10 mM Na2HPO4 ...
-
bioRxiv - Biochemistry 2020Quote: ... Levels of adiponectin in the CM were determined after a 1:1000 dilution using the adiponectin mouse ELISA kit (Biomatik, EKL54022). Levels of IL-6 were measured after a 1:2 CM dilution using the IL-6 mouse ELISA kit (Thermo-Fisher ...
-
bioRxiv - Immunology 2021Quote: ... Plates were washed twice with PBS and incubated at room temperature for 1 hour with 0.5mM of the following peptides (Biomatik, Kitchener, Canada) in PBS ...
-
bioRxiv - Cell Biology 2023Quote: ... CEP192 144-337 region was synthesized and cloned in pGEX-6P-1 plasmid for the GST tag at N-terminus (Biomatik, Canada). Site-directed mutations were generated using specific primers for amplification with Phusion High-fidelity DNA polymerase (New England Biolabs ...
-
bioRxiv - Immunology 2023Quote: ... A duplicate set of expression constructs were also cloned into the pGEX-4T-1 expression vector as single-tagged GST (N-terminal) recombinant constructs (Biomatik, USA), resulting in a total of fourteen recombinant proteins ...
-
bioRxiv - Cell Biology 2022Quote: ... The rabbit anti-BUBR1-pS676 antibody was raised against phospho-S676 of human BUBR1 using the following peptide C-PIIED[pS]REATH (custom made by Biomatik, 1:200). The rabbit anti-BUBR1-pS670 antibody was raised against phosphor-Ser 670 of human BUBR1 (Nijenhuis et al. ...
-
bioRxiv - Cell Biology 2019Quote: ... The rabbit anti-BUB1-p609 antibody was raised against phospho-Thr 609 of human BUB1 using the following peptide C-AQLAS[pT]PFHKLPVES (custom raised by Biomatik, 1:1000). The rabbit anti-BUBR1-p620 antibody was raised against phospho-Thr 620 of human BUBR1 using the following peptide C-AARFVS[pT]PFHE (custom raised by Moravian ...
-
bioRxiv - Microbiology 2023Quote: ... and the PB2 from A/Anhui/1/2013/H7N3 (GenBank accession number CY181528.1) were commercially synthesized as full-length DNA copies (Biomatik GmbH, Rodgau, Germany) and supplied as plasmid clones ...