Labshake search
Citations for Biomatik Corporation :
1 - 19 of 19 citations for Hyaluronidase PH 20 SPAM1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2024Quote: ... 200 μg of human IRBP-p (peptide 1-20) (Biomatik, Wilmington, DE) was emulsified in Complete Freund’s Adjuvant (1:1 w/v ...
-
bioRxiv - Biochemistry 2022Quote: ... or 20 µM peptide corresponding to APLF459-474 (sequence: Ac-PNEYDLNDSFLDDEEE-NH2, Biomatik, dissolved in assay buffer supplemented with 1 mM EDTA and 5 mM BME ...
-
bioRxiv - Developmental Biology 2019Quote: ... The dilutions of the primary antibodies were as follows: a-RpS5b (peptide antibody generated by Biomatik) 1:1000 ...
-
bioRxiv - Molecular Biology 2022Quote: ... The resulting antibody was validated by Biomatik with ELISA (>1:32,000 ...
-
bioRxiv - Developmental Biology 2019Quote: ... a-RpS5a (peptide antibody was generated by Biomatik) 1 ...
-
bioRxiv - Physiology 2022Quote: Antibodies used were rabbit anti phosphatidylserine (Biomatik, CA30389), mouse anti KCNJ2 (Sigma ...
-
bioRxiv - Developmental Biology 2020Quote: ... or anti-Psi (custom generated rabbit polyclonal antibody, Biomatik) antibodies overnight at 4°C ...
-
bioRxiv - Neuroscience 2023Quote: ... An HRP-conjugate and anti-testosterone antibody (Biomatik, #EKC40192) were added to each well ...
-
bioRxiv - Biochemistry 2023Quote: ... 100 μM substrate was incubated for 90 minutes at room temperature with 20 mM recombinant SortA enzyme and 500 μM FAM-containing peptide (5-carboxyfluorescein-HHHHHHLPETGG, Biomatik) in GF buffer supplemented with 1 mM DTT and 10 mM CaCl2 ...
-
bioRxiv - Microbiology 2024Quote: ... A plasmid library containing an R4 attB site and a stretch of 20 random nucleotides was synthesized (Biomatik, Ontario, Canada). The resulting barcode library was integrated into the R4 attB site of otherwise wild-type strains ...
-
bioRxiv - Molecular Biology 2022Quote: The mLIMCH1-specific primary antibody was commercially generated by Biomatik. The following protein antigen sequence was submitted to Biomatik for antibody synthesis-LEQAGIKVMPAAQRFASQKQLSEEKEAIRDIVLRKENSFLTHQHGNDSEAEGEVVCRL PDLEKDDFAARRARMNQTKPMVPLNQLLYGPY ...
-
bioRxiv - Molecular Biology 2019Quote: ... and 2.5 μL of FITC-conjugated anti-dihydrotestosterone antibody (Biomatik, Wilmington, DE) were added to the cell solution ...
-
bioRxiv - Molecular Biology 2021Quote: ... rabbit polyclonal affinity-purified anti-eIF4E-3 antibodies #967 and #968 1:300 (Biomatik, Ontario, Canada, (40)) anti-GW182 and anti-TIA-1 (AbCam ...
-
bioRxiv - Molecular Biology 2024Quote: ... we created new antibodies against the C-terminal domain of SelN for both zebrafish and mouse isoforms (Biomatik). Cells and 2dpf deyolked and dechorionated zebrafish (according to (Link et al. ...
-
bioRxiv - Molecular Biology 2022Quote: ... Transfected C2C12 cells were fixed and stained following the same protocol and incubated overnight in 5% FBS and 0.1% triton-X 100 in PBS at 4°C with the following antibodies: anti-mLIMCH1 (1:200, Biomatik), anti-Myc (1:200 ...
-
bioRxiv - Neuroscience 2024Quote: Antibodies recognizing the NRG1 intracellular domain were raised in rabbits using the immunizing peptide: DEE(pY)ETTQEYEPAQEP by Biomatik. Antibodies recognizing the phosphorylated peptide DEE(pY)ETTQEYEPAQEP vs ...
-
bioRxiv - Synthetic Biology 2021Quote: ... A 27-amino acid B16-M30 peptide with N-terminal biotin and C-terminal polyhistidine (6xHis) motif for antibody-based detection was synthesized by Biomatik to ~85% purity ...
-
bioRxiv - Cell Biology 2019Quote: ... The MAD1-pT716 used in this study (MAD1-pT716-p1) was a custom rabbit polyclonal phospho-specific antibody generated by Biomatik. Secondary antibodies used for immunofluorescence were highly-cross absorbed goat ...
-
bioRxiv - Plant Biology 2020Quote: ... The binding of NCR044.1 to the phospholipids on the strips was detected using a polyclonal antibody generated in rabbits with custom-synthesized NCR044.1 (Biomatik Corp., Cambridge, ON, CDN). Binding of NCR044.1 to PI4P and PI(3,5)P2 was determined using the PolyPIPosomes (Echelon Biosciences ...