Labshake search
Citations for Anaspec :
1 - 32 of 32 citations for TPH2 Human His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
Neutralizing PD-L1 and PD-L2 Enhances the Efficacy of Immune Checkpoint Inhibitors in Ovarian CancerbioRxiv - Cancer Biology 2020Quote: ... and mouse anti-HIS Hilyte Fluor 488 (Anaspec).
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Cancer Biology 2023Quote: ... 20 nM of His-tagged BRD4 BD1 and 20 nM of biotinylated histone H4 K5/8/12/16(Ac) peptide (AnaSpec) were mixed in 20 mM HEPES pH 7.5 ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We incubated the washed beads with 0.25 mg/mL mouse monoclonal biotinylated anti-His Tag monoclonal antibody (AS-61250-BIOT, Anaspec Inc., Fremont, CA) for 2 hours at 22°C ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Biochemistry 2020Quote: Stock solutions of HiLyte™ Fluor 488- labeled Human Aβ42 (Aβ, 0.1 mg; AnaSpec, USA) were prepared by dissolving the lyophilized peptide (1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... Phagocytosis assays were done by incubating BV2 cells with 100 µM HiLyte™ Fluor 488-labeled human Aβ1-42 (Anaspec #AS-60479-01) for three hours in the presence or absence of the hybrid protein at 37°C for Aβ uptake and at 4°C for surface binding assay following Prasad and Rao (2018).
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...