Labshake search
Citations for Anaspec :
1 - 38 of 38 citations for Recombinant Human SMPDL3A Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... prepared from patient donors) or 200μg recombinant human myelin oligodendrocyte glycoprotein (hMOG 1–125, AS-55158-1000, AnaSpec) emulsified in complete (CFA ...
-
bioRxiv - Biophysics 2020Quote: ... human (Anaspec) was reconstituted with 1.0% NH4OH and aliquoted before freezing ...
-
bioRxiv - Neuroscience 2020Quote: Human Aβ42 (AnaSpec) or human biotin-beta-Amyloid (1-42 ...
-
bioRxiv - Neuroscience 2023Quote: ... Synthetic human Aβ1-42 peptides (Anaspec) were dissolved in hydroxyfluroisopropanol (HFIP ...
-
bioRxiv - Microbiology 2021Quote: ... Recombinant PfQC activities were determined using SensoLyte green glutaminyl cyclase activity assay kit (Anaspec). Briefly ...
-
bioRxiv - Neuroscience 2019Quote: ... recombinant SHSY5Y cells were incubated with varying concentrations of Aβ42 (HiLyte Fluor labeled Aβ42, Anaspec) (50 ...
-
bioRxiv - Neuroscience 2020Quote: ... One mg of lyophilized human Aβ42 (Anaspec) or scrambled Aβ42 (Anaspec ...
-
bioRxiv - Neuroscience 2023Quote: Human Aβ1-42 (Anaspec, Cat.: #AS-20276), Aβ3(pE)-42 (Anaspec ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: Synthetic amidated human amylin was purchased from AnaSpec Inc ...
-
bioRxiv - Neuroscience 2021Quote: ... The synthetic human Aβ1-42 or Aβ40 peptide (AnaSpec) was used for standard curves for each assay ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Microbiology 2019Quote: Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) susceptibility assay was performed as described previously (15) ...
-
bioRxiv - Neuroscience 2022Quote: Unlabeled and FAM-labeled synthetic human Aβ1-42 peptides (Anaspec) were dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Biophysics 2023Quote: The peptide corresponding to human Aβ42 (Anaspec, AS-64129-1, 1 mg) was dissolved in 100 μL of DMSO by vortexing for 30 minutes at room temperature ...
-
bioRxiv - Molecular Biology 2022Quote: ... Purified SIINFEKL peptide from ovalbumin protein (AnaSpec) was added to cells at 25 µg/ml for 4h ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2021Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Microbiology 2023Quote: Antimicrobial peptide susceptibility Human neutrophil defensin-1 (hNP-1) (AnaSpec Incorporated, California, USA) and LL-37 (Sigma ...
-
bioRxiv - Cell Biology 2021Quote: ... human complement 5a receptor 1 (C5aR1) with C5aR-agonist (AnaSpec AS65121, in measuring buffer), human muscarinic 1,2,3,4 ...
-
bioRxiv - Biochemistry 2020Quote: Stock solutions of HiLyte™ Fluor 488- labeled Human Aβ42 (Aβ, 0.1 mg; AnaSpec, USA) were prepared by dissolving the lyophilized peptide (1% NH4OH ...
-
bioRxiv - Neuroscience 2023Quote: The drugs used in this study included the following: human ACTH 1-24 (AnaSpec, USA), 150μg per animal dissolved in 0.9% saline ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 1 μM JAG-1 protein (AnaSpec AS-61298, NC0243900) in a flat bottom 48-well plate (Corning 3548) ...
-
bioRxiv - Biochemistry 2021Quote: Human ACE2 activity was evaluated using SensoLyte® 390 ACE2 Activity Assay Kit (ANASPEC; cat# 72086) according to manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2019Quote: ... MGP 1-64 (the first 64 amino acids of matrix Gla protein, Anaspec), 1 uM ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... Phagocytosis assays were done by incubating BV2 cells with 100 µM HiLyte™ Fluor 488-labeled human Aβ1-42 (Anaspec #AS-60479-01) for three hours in the presence or absence of the hybrid protein at 37°C for Aβ uptake and at 4°C for surface binding assay following Prasad and Rao (2018).
-
bioRxiv - Cell Biology 2020Quote: ... The activity of human MMP1 were measured by a SensoLyte® Plus 520 MMP-1 Assay Kit (AnaSpec, San Jose, CA, USA; AS-72012) according to the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... stimulation -iPSC-MGs were treated for 2 h with vehicle (DMSO) or 1µM Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... iPSC-MGs were treated for 5 minutes with vehicle (DMSO) or 1µM of fluorescently labeled Aβ (1-40) TAMRA (human Aβ, AnaSpec # AS-60488; (Paolicelli et al., 2017)) prepared in microglia basal media with growth factors ...
-
bioRxiv - Neuroscience 2022Quote: ... Fluorescent labeling of intermediate curli was performed using a HiLyte Fluor 555 protein labeling kit (Anaspec AS-72045). An aliquot of curli or curli-HiLyte555 was thawed from −80 °C ...
-
bioRxiv - Neuroscience 2019Quote: ... Single cells were re-plated onto matrigel treated coverslips at low density in the presence of 10nM PACAP protein (AnaSpec) or 0.01% DMSO (Sigma) ...
-
bioRxiv - Bioengineering 2022Quote: ... ACE2-expressing HEK293T and HEK293T control cells were lysed and the activity of the ACE protein was assessed by the SensoLyte 390 ACE2 Activity Assay Kit (AnaSpec, USA) according to the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2023Quote: ... One mg of each protein was labeled with a 10-fold molar excess of TMR 5-iodoacetamide (5-TMRIA; Anaspec, San Jose, CA) per cysteine (from a stock concentration of 20 mM in dimethylformamide ...