Labshake search
Citations for Anaspec :
1 - 47 of 47 citations for Beta Glucuronidase GUSB Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2024Quote: ... Amyloid-beta (AnaSpec, USA) was added at 10μM for 24 hours to induce toxicity ...
-
bioRxiv - Neuroscience 2021Quote: Amyloid-beta (Aβ1-42) (AnaSpec; Fremont, CA) was prepared using two different methods as indicated in the figure legends (Methods A or B) ...
-
bioRxiv - Neuroscience 2021Quote: ... beta-Amyloid (1-42) (Anaspec, AS-60883), Thioflavin S (Sigma T1892) ...
-
bioRxiv - Neuroscience 2021Quote: ... Amyloid-beta (Aβ1-42) peptide (AnaSpec; Fremont, CA) was dissolved in Hexafluoro-2-propanol (HFIP ...
-
bioRxiv - Neuroscience 2020Quote: Amyloid-beta (Aβ) peptides were purchased from AnaSpec and solubilized in a manner analogous to previous protocols (Stine et al. ...
-
bioRxiv - Neuroscience 2020Quote: ... or human biotin-beta-Amyloid (1-42) (AnaSpec) was dissolved in dimethyl sulfoxide (DMSO) ...
-
bioRxiv - Neuroscience 2022Quote: ... or 2 μg/mL fluorescent beta-amyloid (Anaspec). Image masks for fluorescence area and phase were generated using IncuCyte 2020C software.
-
bioRxiv - Neuroscience 2019Quote: Amyloid beta-42 (Aβ42) was purchased from AnaSpec, Fremont ...
-
bioRxiv - Neuroscience 2022Quote: ... amyloid beta 1-42 peptide (AnaSpec AS-72216) was oligomerized to prepare soluble amyloid beta species as previously described [44 ...
-
bioRxiv - Neuroscience 2020Quote: Human amyloid-beta (Aβ1-42) was purchased from AnaSpec. ...
-
bioRxiv - Neuroscience 2023Quote: Stock solutions of amyloid beta 1-42 peptide (Anaspec) were resuspended in PBS ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: A-beta (1-42) peptide was obtained from AnaSpec (cat# AS-20276 ...
-
bioRxiv - Neuroscience 2022Quote: ... beta-amyloid(1-40)-Lys(biotin-LC) (AS-23517, Anaspec), was diluted into assay buffer at 1 µg/mL and immobilized onto streptavidin coated biosensors (#18-5019 ...
-
bioRxiv - Biophysics 2021Quote: The commercially available amyloid Beta 40 (Aβ 40) was purchased from AnaSpec, inc ...
-
bioRxiv - Cell Biology 2023Quote: ... Oligomers of amyloid beta peptide were obtained from lyophilized Aβ1-42 (Anaspec), which was firstly dissolved in 1,1,1,3,3,3-hexafluoro-2-propanol ...
-
bioRxiv - Immunology 2023Quote: ... 1 µL of HiLyte™ Fluor 488-labeled Amyloid-beta (1-42) (Anaspec) prepared by reconstituting 0.1mg in 50 µL of 1% NH4OH ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: The procedure was performed as described by the manufacturer’s instructions (SensoLyte ® Thioflavin T Beta Amyloid (1-42) Aggregation Kit (Anaspec)) ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Bioengineering 2019Quote: Human beta-amyloid (1-42) (Aβ) and scrambled Aβ (1-42) (Scr Aβ) (AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA) was purchased from AnaSpec (Fremont, CA) and Genscript (Piscataway ...
-
bioRxiv - Immunology 2021Quote: ... and custom Mouse amyloid-beta 42 labeled with HiLyte 488 (SQ-ANCPXXXX) were all purchased from Anaspec (Fremont, CA, USA). ACK lysing buffer (10-548E ...
-
bioRxiv - Molecular Biology 2020Quote: Both cell lines were incubated with media supplemented with 200nM human Beta-Amyloid (1-42) HiLyte Fluor 555 (AnaSpec, Fremont, CA, USA), with or without thiethylperazine (MilliporeSigma ...
-
bioRxiv - Neuroscience 2022Quote: ... and incubated overnight at 4ºC with the primary antibody: rabbit polyclonal antibody against P2RY12 (1:250, #AS-55043A, AnaSpec Inc.). The secondary antibody was ...
-
bioRxiv - Cell Biology 2020Quote: ... Antibodies concentration: anti-Tp53 (1:1000, Anaspec, 55342); anti-g-H2AX (1:1000 ...
-
bioRxiv - Cell Biology 2024Quote: ... Antibodies concentrations: anti-p53 (1:1000, Anaspec, 55342), anti TBK1 (1:1000 ...
-
bioRxiv - Biochemistry 2023Quote: ... followed by HRP-conjugated secondary antibody (Anaspec, 1:2000). Antibodies were dissolved in 1X TBS with 0.05% Tween-20 ...
-
bioRxiv - Plant Biology 2023Quote: ... Custom RIN4 antibody was generated by AnaSpec (Fremont, CA, USA) and used at 1:5000 dilution in 5% Milk ...
-
bioRxiv - Neuroscience 2023Quote: ... The primary antibodies to rabbit anti-Elp1 (1:1500) (Anaspec, #AS_54494)) and rabbit anti-GFP (1:2000 ...
-
bioRxiv - Developmental Biology 2022Quote: ... followed by incubation with P2ry12 antibody (Catalog# AS-55043A, AnaSpec, Fremont, CA) overnight at 4•C and then incubated with goat anti-rabbit Alexa Fluor 488 or 647 (Thermo Fischer Scientific ...
-
bioRxiv - Developmental Biology 2019Quote: ... Primary antibodies Rabbit anti-Vangl2 (1:100, Anaspec, AS-55659s, now discontinued) and Mouse anti β-II-Spectrin (1:200 ...
-
bioRxiv - Developmental Biology 2019Quote: ... Western Blot was performed using 1:500 dilution of Celsr1a antibody (AnaSpec. Inc).
-
bioRxiv - Molecular Biology 2019Quote: Primary antibodies used for immunoblotting were as follows: anti-IKAP (Anaspec, cat# 54494), anti-acetylated α-tubulin (Sigma ...
-
bioRxiv - Neuroscience 2021Quote: ... The following primary antibodies were used: rabbit anti-P2Y12R (1:500, #55043AS AnaSpec), chicken anti-GFP-tag (1:500 ...
-
bioRxiv - Cell Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
bioRxiv - Plant Biology 2023Quote: ... the sections were reacted with polyclonal anti-GFP antibody (AnaSpec, Fremont, CA, US) diluted 1:500 in 3% (w/v ...
-
bioRxiv - Cell Biology 2020Quote: ... the membrane was incubated with the primary antibody (rabbit anti-Sarm1, 1:500, ANASPEC 55381 ...
-
bioRxiv - Neuroscience 2020Quote: ... and primary antibodies (rabbit anti-Iba1, 1:500 Wako #016-26461; rabbit anti-P2y12, 1:500 Anaspec #AS-55043A ...
-
bioRxiv - Neuroscience 2021Quote: ... Sections were then incubated in different mixtures of primary antibodies: rabbit anti-P2Y12R (1:500, #55043AS AnaSpec), chicken anti-GFAP (1:500 ...
-
bioRxiv - Neuroscience 2023Quote: ... The following primary antibodies were used: 1) rabbit anti-pT217-tau at 1:200 (cat# AS-54968, Anaspec). The immunogen used KLH conjugated with synthetic peptides corresponding to human tau at phosphorylated threonine 217 ...
-
bioRxiv - Neuroscience 2022Quote: ... Pre-treatments included mixing Aβ42-HiLyteFluor-555 with 1 μg of blocking antibodies (α-Aβ42-Ab, Anaspec, Fremont, CA) for 15 min at room temperature prior to adding viral particles or pretreating the HSV-1-gB-GFP for 30 min at room temperature with 1% NP40 to disrupt the viral envelope ...
-
A Novel PHOX/CD38/MCOLN1/TFEB Axis Important For Macrophage Activation During Bacterial PhagocytosisbioRxiv - Immunology 2019Quote: ... Cells were washed thrice in PBS and incubated with the fluorescent secondary antibody plus Hoechst stain (Anaspec, AS-83218) at room temperature for 1 h ...
-
bioRxiv - Neuroscience 2023Quote: ... for 30 min and incubated with blocking solution (5% normal bovine serum in PBST) for 1 h followed by rabbit anti-P2Y12 antibody (AS-55043A, AnaSpec) together with goat anti-Iba1 antibody (ab5076 ...
-
bioRxiv - Neuroscience 2023Quote: ... Secondary antibodies were goat anti-rabbit (Pierce, Cat.No.31462, 1:10000) and goat anti-mouse (AnaSpec, Cat.No.28173, 1:10000). All antibodies were diluted in I-BlockTM protein-based blocking reagent (Applied Biosystems ...
-
bioRxiv - Immunology 2021Quote: ... slides were incubated in blocking at RT for 1 h before overnight incubation at 4°C with the primary rabbit anti-P2Y12 receptor antibody (1:200, AnaSpec #AS-55043A) and labelling for 1 hour with the secondary antibody AF488 goat anti-rabbit ...
-
Long-Range Electrostatic Interactions Significantly Modulate the Affinity of Dynein for MicrotubulesbioRxiv - Biophysics 2021Quote: ... We incubated the washed beads with 0.25 mg/mL mouse monoclonal biotinylated anti-His Tag monoclonal antibody (AS-61250-BIOT, Anaspec Inc., Fremont, CA) for 2 hours at 22°C ...
-
bioRxiv - Neuroscience 2023Quote: ... + 1xPBS + .03% Triton + primary antibodies (chicken anti-Iba1: 1:1000, Synaptic Systems 234 009; rabbit anti-P2RY12: 1:500, Anaspec AS-55043A). After primary antibody incubation ...
-
bioRxiv - Microbiology 2020Quote: ... The proteins were then probed for baboon APOL1 using anti-baboon APOL1 antibody (rabbit anti-sera raised against the following peptide: CSVEERARVVEMERVAESRTTEVIRGAKIVDK, AnaSpec Incorporated, 1:1000) and anti-Hp antibody (H8636 - 1:10,000) ...