Labshake search
Citations for ProteoGenix :
1 - 22 of 22 citations for Tubulin Delta 1 TUBD1 Antibody HRP since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/uL anti-SEMA4D monoclonal antibody (Pepinemab Biosimilar, Proteogenix PX-TA1382 or 1 ng/uL anti-PLXNB2 monoclonal antibody (67265-1 ...
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
Immunogenic fusion proteins induce neutralizing SARS-CoV-2 antibodies in the serum and milk of sheepbioRxiv - Bioengineering 2022Quote: ... Plates were then washed six times with 1X PBS with 0.05% Tween (PBST) before 120 μL of ACE2-HRP protein (ProteoGenix, France) at a 1:200 dilution in 1X PBS containing 2% milk powder (PBSM ...
-
bioRxiv - Plant Biology 2020Quote: ... Rabbit polyclonal antibodies against PAP8 were produced by ProteoGenix. In Western blots PAP8 is detected at ~38 kDa ...
-
bioRxiv - Cell Biology 2021Quote: ... which were subcloned before antibody production (Proteogenix, Schiltigheim, France).
-
bioRxiv - Plant Biology 2020Quote: ... Polyclonal antibodies against FAP were raised in rabbits (ProteoGenix, Schiltigheim, France).
-
bioRxiv - Developmental Biology 2022Quote: ... All antibodies were generated and affinity-purified by Proteogenix (Schiltigheim, France).
-
bioRxiv - Microbiology 2019Quote: ... or an anti-FtsZ antibody (produced by Proteogenix, Supplementary Fig. 21b) for 1 h at room temperature ...
-
bioRxiv - Genetics 2020Quote: ... IF:1:50), TAF-6 (TAF2G7, wb: 1:500) and TAF-10 (6TA-2B11, wb: 1:500) were from ProteoGenix. Streptavidin-HRP (wb ...
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Microbiology 2023Quote: ... generating a polyclonal antibody against the tyrosine-phosphorylated intracellular portion of BST2 (Proteogenix).
-
bioRxiv - Genomics 2023Quote: ... Yeast cells were synchronised in G1 by adding of α-factor (Antibodies-online, ABIN399114 or Proteogenix, WY-13) in the media every 30 min during 2h30 (1µg/mL final).
-
bioRxiv - Cell Biology 2021Quote: Binding of anti-Unc5B antibodies to Human or Rat Unc5B was performed using a Biacore™ 8K (Proteogenix, Schiltigheim, France). Human or Rat Unc5B-ECD-Fc (R&D Systems ...
-
bioRxiv - Plant Biology 2022Quote: ... or 1 uM flg22 (EZBiolabs, USA or Proteogenix, France), or water ...
-
bioRxiv - Cell Biology 2022Quote: ... two synthesized antigen peptides Cys- TMSLKLKRGNKEKIESALSDA and Cys-DYKKKELALKRLITKAMATR (Figure S1C) were conjugated to KLH carrier and used for raising polyclonal antibody in rabbits (ProteoGenix, France). The detection of HscA using polyclonal antibody was performed by analyzing the protein extracts of A ...
-
bioRxiv - Microbiology 2020Quote: ... the rabbit anti-FRDm2 (aFRDm2, 1:100, produced by Proteogenix from the EISKSVFPDASLGV and ELGHNKSNIVTL peptides) ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-penetratin (positive control, TAMRA -RQIKIWFQNRRMKWKK-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...