Labshake search
Citations for ProteoGenix :
1 - 26 of 26 citations for Recombinant Mouse Programmed Cell Death 1 Ligand 2 His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2021Quote: ... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Plant Biology 2023Quote: ... was codon-optimized for Pichia pastoris and synthesized without signal peptide in frame with His-tag in pPCIZ-αB by ProteoGenix (Schiltigheim, France). rTBL38 was produced in P ...
-
bioRxiv - Microbiology 2023Quote: The full-length PfS1 recombinant purified protein was used to immunized rabbits subcutaneously following a two-months standard procedure (Proteogenix, France). Briefly ...
-
bioRxiv - Biochemistry 2019Quote: ... and 1548 (codon 516) (starting at ATG) and was cloned into the vector pUC57 to generate the recombinant plasmid pUC57ltgA (ProteoGenix, Schiltigheim, France). The ltgA fragment was amplified using the primer pair NMF1/NMR1 from the plasmid pUC57ltgA and from the strain MC58 ...
-
bioRxiv - Microbiology 2022Quote: ... and SARS-CoV-2 M protein was purchased from ProteoGenix (Catalog# PX-COV-P025).
-
bioRxiv - Bioengineering 2023Quote: ... The peptide solution (CGGRGDSPG, Proteogenix, free of TFA, 1.6 mg/ mL in PBS; 2 mL) was added to the emulsion and incubated for 1 h at room temperature ...
-
bioRxiv - Genetics 2020Quote: ... IF:1:50), TAF-6 (TAF2G7, wb: 1:500) and TAF-10 (6TA-2B11, wb: 1:500) were from ProteoGenix. Streptavidin-HRP (wb ...
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Biochemistry 2021Quote: ... of SARS-CoV-2 (acNLNSSRVPDLLVCOOH) or of it South African mutant P71L (acNLNSSRVLDLLVCOOH) were synthesized in solid phase using the Fmoc strategy (Proteogenix, Schiltigheim, France). Peptides were resuspended in water to prepare stock solutions.
-
bioRxiv - Plant Biology 2022Quote: ... or 1 uM flg22 (EZBiolabs, USA or Proteogenix, France), or water ...
-
bioRxiv - Microbiology 2020Quote: ... the rabbit anti-FRDm2 (aFRDm2, 1:100, produced by Proteogenix from the EISKSVFPDASLGV and ELGHNKSNIVTL peptides) ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/uL anti-SEMA4D monoclonal antibody (Pepinemab Biosimilar, Proteogenix PX-TA1382 or 1 ng/uL anti-PLXNB2 monoclonal antibody (67265-1 ...
-
bioRxiv - Genetics 2023Quote: ... Yeast cells were synchronized in G1 by adding α-factor (Proteogenix, WY-13) in the media every 30 min during 2h30 (1 μg/mL final) ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-penetratin (positive control, TAMRA -RQIKIWFQNRRMKWKK-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH ...
-
bioRxiv - Immunology 2021Quote: ... Peripheral blood mononuclear cells (PBMCs) were isolated by Ficoll-Paque density gradient (Lymphoprep, Proteogenix) from the blood of patients and healthy donors ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
bioRxiv - Immunology 2024Quote: ... Leukocytes were purified by combining polymorphonuclear and mononuclear cell layers using Polymorphprep reagent (ProteoGenix, Schiltigheim, France) at room temperature ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...
-
bioRxiv - Microbiology 2020Quote: Activated CD4+ T cells were incubated with 6uM RT53-Rhodamine [Rhodamine-RQIKIWFQNRRMKWKKAKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKT] or RK16-Rhodamine [Rhodamine-RQIKIWFQNRRMKWKK] (Proteogenix) for 2 hours ...
-
bioRxiv - Genomics 2023Quote: ... Yeast cells were synchronised in G1 by adding of α-factor (Antibodies-online, ABIN399114 or Proteogenix, WY-13) in the media every 30 min during 2h30 (1µg/mL final).
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Immunology 2023Quote: ... naïve T-cells were seeded in 96-well U-bottom together with bone marrow-derived dendritic cells (BMDCs) loaded with the indicated OVA peptide (Proteogenix) at 10 ng/mL or antibodies ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...