Labshake search
Citations for ProteoGenix :
1 - 21 of 21 citations for Recombinant Human Neuropilin 1 His tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2021Quote: ... 150 pmol of 6×His-streptavidin (ProteoGenix) was mixed with 5 μl of sieved beads (10% ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Plant Biology 2023Quote: ... was codon-optimized for Pichia pastoris and synthesized without signal peptide in frame with His-tag in pPCIZ-αB by ProteoGenix (Schiltigheim, France). rTBL38 was produced in P ...
-
bioRxiv - Microbiology 2023Quote: The full-length PfS1 recombinant purified protein was used to immunized rabbits subcutaneously following a two-months standard procedure (Proteogenix, France). Briefly ...
-
bioRxiv - Neuroscience 2019Quote: ... Cell-permeable recombinant human c-MYC was purchased from Abcam (ab169901) and human GBX2 (hGBX2) and LHX9 (hLHX9) were purchased from Proteogenix. Endotoxins were removed by phase separation according to Aida and Pabst ...
-
bioRxiv - Immunology 2022Quote: ... The pcDNA3.1 vector coding for human IL-15 was synthesized by ProteoGenix SAS (Strasbourg ...
-
bioRxiv - Biochemistry 2019Quote: ... and 1548 (codon 516) (starting at ATG) and was cloned into the vector pUC57 to generate the recombinant plasmid pUC57ltgA (ProteoGenix, Schiltigheim, France). The ltgA fragment was amplified using the primer pair NMF1/NMR1 from the plasmid pUC57ltgA and from the strain MC58 ...
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Cell Biology 2021Quote: Binding of anti-Unc5B antibodies to Human or Rat Unc5B was performed using a Biacore™ 8K (Proteogenix, Schiltigheim, France). Human or Rat Unc5B-ECD-Fc (R&D Systems ...
-
bioRxiv - Genetics 2020Quote: ... IF:1:50), TAF-6 (TAF2G7, wb: 1:500) and TAF-10 (6TA-2B11, wb: 1:500) were from ProteoGenix. Streptavidin-HRP (wb ...
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Plant Biology 2022Quote: ... or 1 uM flg22 (EZBiolabs, USA or Proteogenix, France), or water ...
-
bioRxiv - Microbiology 2020Quote: ... the rabbit anti-FRDm2 (aFRDm2, 1:100, produced by Proteogenix from the EISKSVFPDASLGV and ELGHNKSNIVTL peptides) ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/uL anti-SEMA4D monoclonal antibody (Pepinemab Biosimilar, Proteogenix PX-TA1382 or 1 ng/uL anti-PLXNB2 monoclonal antibody (67265-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-penetratin (positive control, TAMRA -RQIKIWFQNRRMKWKK-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...