Labshake search
Citations for ProteoGenix :
1 - 11 of 11 citations for Human Mitochondrial Open Reading Frame Of The 12S rRNA c MOTS c CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Plant Biology 2023Quote: ... was codon-optimized for Pichia pastoris and synthesized without signal peptide in frame with His-tag in pPCIZ-αB by ProteoGenix (Schiltigheim, France). rTBL38 was produced in P ...
-
bioRxiv - Neuroscience 2019Quote: ... Cell-permeable recombinant human c-MYC was purchased from Abcam (ab169901) and human GBX2 (hGBX2) and LHX9 (hLHX9) were purchased from Proteogenix. Endotoxins were removed by phase separation according to Aida and Pabst ...
-
bioRxiv - Immunology 2022Quote: ... The pcDNA3.1 vector coding for human IL-15 was synthesized by ProteoGenix SAS (Strasbourg ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Cell Biology 2021Quote: Binding of anti-Unc5B antibodies to Human or Rat Unc5B was performed using a Biacore™ 8K (Proteogenix, Schiltigheim, France). Human or Rat Unc5B-ECD-Fc (R&D Systems ...