Labshake search
Citations for ProteoGenix :
1 - 14 of 14 citations for Human Low affinity immunoglobulin gamma Fc region receptor II c FCGR2C ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Developmental Biology 2022Quote: ... All antibodies were generated and affinity-purified by Proteogenix (Schiltigheim, France).
-
bioRxiv - Microbiology 2023Quote: Peptides corresponding to the amyloidogenic regions detected within the TasA amyloid core were synthetically produced and purified by Proteogenix (Schiltigheim, France). The sequence of the peptides was ...
-
bioRxiv - Plant Biology 2021Quote: ... followed by three copies of the FLAG octapeptide tag coding region (3xFLAG) and driven by the Aspergillus nidulans gpdA promoter and the SV40 late polyadenylation signal was synthesized by ProteoGenix (Schiltigheim, France). Codon-optimization of mClover3 was performed in accordance with F ...
-
bioRxiv - Plant Biology 2023Quote: ... The 6xHis-PhDEF protein was purified by affinity column with a Nickel resin under denaturing conditions (8M urea) by Proteogenix. The purified protein was injected in two rabbits for immunization by Proteogenix ...
-
bioRxiv - Neuroscience 2019Quote: ... Cell-permeable recombinant human c-MYC was purchased from Abcam (ab169901) and human GBX2 (hGBX2) and LHX9 (hLHX9) were purchased from Proteogenix. Endotoxins were removed by phase separation according to Aida and Pabst ...
-
bioRxiv - Immunology 2022Quote: ... The pcDNA3.1 vector coding for human IL-15 was synthesized by ProteoGenix SAS (Strasbourg ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Cell Biology 2021Quote: Binding of anti-Unc5B antibodies to Human or Rat Unc5B was performed using a Biacore™ 8K (Proteogenix, Schiltigheim, France). Human or Rat Unc5B-ECD-Fc (R&D Systems ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...