Labshake search
Citations for ProteoGenix :
1 - 20 of 20 citations for C Reactive Protein CRP ELISA Kit 5 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...
-
bioRxiv - Cell Biology 2022Quote: ... TAMRA(5-Carboxytetramethylrhodamine)-peptides were synthetized by ProteoGenix (France).
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Neuroscience 2021Quote: FTO protein was provided by ProteoGenics SAS (Schiltigheim, France, www.ProteoGenix.science.com). The details of the protein synthesis are given in Supplementary material ...
-
bioRxiv - Plant Biology 2023Quote: ... The purified protein was injected in two rabbits for immunization by Proteogenix, to generate PhDEF-directed polyclonal antibodies ...
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Microbiology 2022Quote: ... and SARS-CoV-2 M protein was purchased from ProteoGenix (Catalog# PX-COV-P025).
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
bioRxiv - Biochemistry 2021Quote: ... we adopted a FRET-based assay using the substrate 5-FAM-AVLQISGFRK(DABCYL)K (Proteogenix). The assay was performed by mixing 0.05 μM Mpro with different concentrations of substrate (1-128 μM ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Cell Biology 2022Quote: ... 5’-AAC CGC AAT CAC ATC CAC GA-3’/5’-CAC CTC TGC CAT GAT CAC CG-3’) and the repair template (synthesized by ProteoGenix). The repair template was composed of two homology arms of 1000 bp flanking a puromycin resistance gene and mClover3 coding sequence separated by a P2A cleavage site ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Molecular Biology 2020Quote: ... was generated by PCR amplification extended on its 3′-end with a 5′-(CAA)9CAC-3′ tail from plasmid containing the gene synthetized by Proteogenix. The PCR product purification and in vitro transcription of mouse H4–12 mRNA were performed as described for the preparation of β-globin mRNA ...
-
bioRxiv - Microbiology 2022Quote: ... The peptide corresponding to the periplasmic extension of ExbBsm (A1PAANPAVTESVAPTTAPAPAAAAPESITPVNPAPTIQPPETRG44-numbering with reference to the mature protein) was synthetized by Proteogenix.
-
Immunogenic fusion proteins induce neutralizing SARS-CoV-2 antibodies in the serum and milk of sheepbioRxiv - Bioengineering 2022Quote: ... Plates were then washed six times with 1X PBS with 0.05% Tween (PBST) before 120 μL of ACE2-HRP protein (ProteoGenix, France) at a 1:200 dilution in 1X PBS containing 2% milk powder (PBSM ...
-
bioRxiv - Plant Biology 2023Quote: ... The 6xHis-PhDEF protein was purified by affinity column with a Nickel resin under denaturing conditions (8M urea) by Proteogenix. The purified protein was injected in two rabbits for immunization by Proteogenix ...
-
bioRxiv - Microbiology 2023Quote: The full-length PfS1 recombinant purified protein was used to immunized rabbits subcutaneously following a two-months standard procedure (Proteogenix, France). Briefly ...
-
bioRxiv - Immunology 2022Quote: ... was blocked via the pretreatment of PLTs with 5 μg/mL anti-SELP humanized Ab (anti-CD62p, 15 min, RT; ProteoGenix, Schiltigheim, France). Using a modified FC approach that detects PLT-leukocyte aggregates ...