Labshake search
Citations for ProteoGenix :
1 - 16 of 16 citations for 7H Pyrrolo 2 3 d pyrimidin 2 amine 7 3 5 bis O 2 4 dichlorophenyl methyl 2 C methyl b D ribofuranosyl 4 chloro since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: ... and SARS-CoV-2 M protein was purchased from ProteoGenix (Catalog# PX-COV-P025).
-
bioRxiv - Bioengineering 2023Quote: ... The peptide solution (CGGRGDSPG, Proteogenix, free of TFA, 1.6 mg/ mL in PBS; 2 mL) was added to the emulsion and incubated for 1 h at room temperature ...
-
bioRxiv - Cell Biology 2022Quote: ... 5’-AAC CGC AAT CAC ATC CAC GA-3’/5’-CAC CTC TGC CAT GAT CAC CG-3’) and the repair template (synthesized by ProteoGenix). The repair template was composed of two homology arms of 1000 bp flanking a puromycin resistance gene and mClover3 coding sequence separated by a P2A cleavage site ...
-
bioRxiv - Molecular Biology 2020Quote: ... was generated by PCR amplification extended on its 3′-end with a 5′-(CAA)9CAC-3′ tail from plasmid containing the gene synthetized by Proteogenix. The PCR product purification and in vitro transcription of mouse H4–12 mRNA were performed as described for the preparation of β-globin mRNA ...
-
bioRxiv - Biochemistry 2021Quote: ... of SARS-CoV-2 (acNLNSSRVPDLLVCOOH) or of it South African mutant P71L (acNLNSSRVLDLLVCOOH) were synthesized in solid phase using the Fmoc strategy (Proteogenix, Schiltigheim, France). Peptides were resuspended in water to prepare stock solutions.
-
bioRxiv - Immunology 2022Quote: ... and a Coleoptericin B (ColB) primary polyclonal anti-serum (Proteogenix, Schiltigheim-France) at 1:300 dilution in 0.1% BSA were used ...
-
bioRxiv - Cell Biology 2022Quote: ... TAMRA(5-Carboxytetramethylrhodamine)-peptides were synthetized by ProteoGenix (France).
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Neuroscience 2020Quote: ... Preabsorption controls in human sections were performed by using the APP C-terminal peptide sequence KMQQNGYENPTYKFFEQMQN (Proteogenix) at 1 μg/ml and Y188 or C1/6.1 at 1 μg/ml (equal mass concentration ...
-
bioRxiv - Biochemistry 2021Quote: ... we adopted a FRET-based assay using the substrate 5-FAM-AVLQISGFRK(DABCYL)K (Proteogenix). The assay was performed by mixing 0.05 μM Mpro with different concentrations of substrate (1-128 μM ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM mutated TAMRA-C-ter BDNF peptide (CellPDD predicting score = 0.03, i.e. mutation abolishing the CPP characteristics : TAMRA-KKEIGWRFIRIDTSCVCTLTIKEGR-COOH; Proteogenix, France), with 1 μM TAMRA-penetratin (positive control ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured on polylysine coverslips and incubated with the TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) corresponding to the 25 amino acids of the C-terminal sequence of BDNF at 1 μM ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Immunology 2022Quote: ... was blocked via the pretreatment of PLTs with 5 μg/mL anti-SELP humanized Ab (anti-CD62p, 15 min, RT; ProteoGenix, Schiltigheim, France). Using a modified FC approach that detects PLT-leukocyte aggregates ...