Labshake search
Citations for ProteoGenix :
1 - 21 of 21 citations for 7 Chloro 2 hydrazino 5 phenyl 3H 1 4 benzodiazepine since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... TAMRA(5-Carboxytetramethylrhodamine)-peptides were synthetized by ProteoGenix (France).
-
bioRxiv - Biochemistry 2021Quote: ... we adopted a FRET-based assay using the substrate 5-FAM-AVLQISGFRK(DABCYL)K (Proteogenix). The assay was performed by mixing 0.05 μM Mpro with different concentrations of substrate (1-128 μM ...
-
bioRxiv - Microbiology 2022Quote: ... and SARS-CoV-2 M protein was purchased from ProteoGenix (Catalog# PX-COV-P025).
-
bioRxiv - Bioengineering 2023Quote: ... The peptide solution (CGGRGDSPG, Proteogenix, free of TFA, 1.6 mg/ mL in PBS; 2 mL) was added to the emulsion and incubated for 1 h at room temperature ...
-
bioRxiv - Genetics 2020Quote: ... IF:1:50), TAF-6 (TAF2G7, wb: 1:500) and TAF-10 (6TA-2B11, wb: 1:500) were from ProteoGenix. Streptavidin-HRP (wb ...
-
bioRxiv - Biochemistry 2021Quote: The lyophilized TOST-1 and PID-1 peptides were purchased from Proteogenix at 95 % purity ...
-
bioRxiv - Cell Biology 2022Quote: ... 5’-AAC CGC AAT CAC ATC CAC GA-3’/5’-CAC CTC TGC CAT GAT CAC CG-3’) and the repair template (synthesized by ProteoGenix). The repair template was composed of two homology arms of 1000 bp flanking a puromycin resistance gene and mClover3 coding sequence separated by a P2A cleavage site ...
-
bioRxiv - Developmental Biology 2019Quote: ... we synthetized several 5-fluorescein amidite (5-FAM)-conjugated peptide substrates based on the human HSF2 sequence and containing various lysine residues of interest (Proteogenix):
-
bioRxiv - Molecular Biology 2020Quote: ... was generated by PCR amplification extended on its 3′-end with a 5′-(CAA)9CAC-3′ tail from plasmid containing the gene synthetized by Proteogenix. The PCR product purification and in vitro transcription of mouse H4–12 mRNA were performed as described for the preparation of β-globin mRNA ...
-
bioRxiv - Immunology 2022Quote: ... was blocked via the pretreatment of PLTs with 5 μg/mL anti-SELP humanized Ab (anti-CD62p, 15 min, RT; ProteoGenix, Schiltigheim, France). Using a modified FC approach that detects PLT-leukocyte aggregates ...
-
bioRxiv - Biochemistry 2021Quote: ... of SARS-CoV-2 (acNLNSSRVPDLLVCOOH) or of it South African mutant P71L (acNLNSSRVLDLLVCOOH) were synthesized in solid phase using the Fmoc strategy (Proteogenix, Schiltigheim, France). Peptides were resuspended in water to prepare stock solutions.
-
bioRxiv - Plant Biology 2022Quote: ... or 1 uM flg22 (EZBiolabs, USA or Proteogenix, France), or water ...
-
bioRxiv - Microbiology 2020Quote: ... the rabbit anti-FRDm2 (aFRDm2, 1:100, produced by Proteogenix from the EISKSVFPDASLGV and ELGHNKSNIVTL peptides) ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/uL anti-SEMA4D monoclonal antibody (Pepinemab Biosimilar, Proteogenix PX-TA1382 or 1 ng/uL anti-PLXNB2 monoclonal antibody (67265-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-penetratin (positive control, TAMRA -RQIKIWFQNRRMKWKK-COOH; Proteogenix, France), with 1 μM TAMRA-sheperdin (TAMRA-KHSSGCAFL-COOH ...
-
bioRxiv - Cell Biology 2022Quote: ... with 1 μM TAMRA-sheperdin-C-ter BDNF (TAMRA-KHSSGCAFLKKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France), or with TAMRA fluorophore alone for 20 minutes ...
-
bioRxiv - Microbiology 2023Quote: Blots were incubated with antibodies (1/3000 dilution) purified on G-protein (Proteogenix, France), followed by horseradish peroxidase-conjugated (HRP ...
-
bioRxiv - Biochemistry 2021Quote: The palustrin-Ca peptide (MW=3304 g mol-1, purity >95%) was purchased from ProteoGenix (Paris). 4.5 g of the peptide was dissolved in 0.6 mL of a 50% (v/v ...
-
bioRxiv - Genomics 2022Quote: A peptide corresponding to PgmL1 amino acid sequence 1 to 266 and carrying a C-terminal His tag was used for guinea pig immunization (Proteogenix). Sera were purified by antigen affinity purification to obtain highly specific α−PgmL1-GP antibodies (0.8 mg/mL) ...
-
bioRxiv - Cell Biology 2022Quote: Cells were cultured in a 12 well-plate and incubated with 1 μM TAMRA-C-ter BDNF (TAMRA-KKRIGWRFIRIDTSCVCTLTIKRGR-COOH; Proteogenix, France) for 40 minutes in incubation chamber at 37°C in a 5% CO2 atmosphere ...