Labshake search
Citations for Lampire Biological Laboratories :
1 - 20 of 20 citations for WAS Protein Family Member 3 WASF3 Antibody Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Molecular Biology 2022Quote: Custom α-Sas6T antiserum was generated by rabbit immunization with purified recombinant Sas6T protein (Lampire Biological Laboratories). The resulting antiserum was used for western blotting and cell staining ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Bioengineering 2020Quote: Bovine blood was purchased from Lampire Biologicals Laboratories (Bovine 7200807-1L ...
-
bioRxiv - Bioengineering 2020Quote: ... Heparinized porcine blood was purchased from Lampire Biological Laboratories ...
-
bioRxiv - Biochemistry 2020Quote: ... Fresh rat serum (RS) was purchased from Lampire Biological Laboratories (Pipersville ...
-
Macrobdella decora: Old World Leech Gut Microbial Community Structure Conserved in a New World LeechbioRxiv - Microbiology 2019Quote: ... Sheep blood with heparin anticoagulant was purchased from Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Bioengineering 2023Quote: Citrated bovine calf whole blood was acquired through venipuncture (Lampire Biological Laboratories, PA) from a single donor animal ...
-
bioRxiv - Bioengineering 2021Quote: Porcine whole blood was obtained from a commercial source (Lampire Biological Laboratories, Pipersville, PA) in 1-liter quantities ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... pertussis strain was grown on Bordet-Gengou (BG) agar plates supplemented with defibrinated sheep blood (10%, Lampire Biological Products ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... The warmed feeder was filled with ∼ 5 ml of heparinized bovine whole blood (Lampire Biological Laboratories, Pipersville, PA, USA) fifteen minutes prior to the beginning of the experiment to allow the blood to heat up ...
-
bioRxiv - Bioengineering 2023Quote: ... One tube (left side in Fig. S5a) was filled with defibrinated bovine blood (Lampire biological laboratories, Pipersville, PA, USA) while circulated using a peristatic pump (model 3386 ...
-
bioRxiv - Immunology 2021Quote: ... Hemagglutination activity of each preparation of VLP was determined by serially diluting volumes of VLPs and adding equal volume 0.8% turkey red blood cells (RBCs) (Lampire Biologicals, Pipersville, PA, USA) suspended in PBS to a V-bottom 96-well plate with a 30 min incubation at room temperature (RT) ...