Labshake search
Citations for Lampire Biological Laboratories :
1 - 13 of 13 citations for T Cell Surface Glycoprotein CD3 Gamma Chain CD3G Antibody Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Immunology 2022Quote: ... and then 0.5% chicken red blood cells (Lampire Biological Laboratories) were added to determine HAI titers ...
-
An egg-derived sulfated N-Acetyllactosamine glycan is an antigenic decoy of influenza virus vaccinesbioRxiv - Immunology 2021Quote: ... 50 μl of 0.5% turkey red blood cells (Lampire Biological) were added to each well and incubated for 45 minutes at room temperature ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were blocked with 100 ug/mL mouse IgG (Lampire Biological Laboratories) or Human TruStain FcX (BioLegend) ...
-
bioRxiv - Immunology 2024Quote: ... 0.75% guinea pig red blood cells (GPRBCs) (Lampire Biologicals, Pipersville, PA, USA) for H3 subtype viruses in the presence of 20nM Oseltamivir ...
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Immunology 2020Quote: ... Immune sera and mAbs were serially diluted and incubated with reporter viruses and then incubated with 0.5% turkey red blood cells (Lampire Biological Laboratories) for 30 min at room temperature ...
-
bioRxiv - Immunology 2023Quote: ... virus strain for 30min at room temperature (RT) prior to addition of 50μL of 1% chicken red blood cells (cRBCs) (Lampire Biological Laboratories) in 1X PBS ...
-
bioRxiv - Immunology 2021Quote: ... Hemagglutination activity of each preparation of VLP was determined by serially diluting volumes of VLPs and adding equal volume 0.8% turkey red blood cells (RBCs) (Lampire Biologicals, Pipersville, PA, USA) suspended in PBS to a V-bottom 96-well plate with a 30 min incubation at room temperature (RT) ...