Labshake search

1 - 10 of 10 citations for Protein CBFA2T2 CBFA2T2 Antibody since 2019

• Interferon ε restricts Zika virus infection in the female reproductive tract

  Chuan Xu, et al., bioRxiv - Immunology 2023

  Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
• N-terminal autoprocessing and acetylation of MARTX Makes-Caterpillars Floppy-like effector is stimulated by ADP-Ribosylation Factor 1 in advance of Golgi fragmentation

  Alfa Herrera, et al., bioRxiv - Microbiology 2019

  Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
• Vibrio MARTX toxin processing and degradation of cellular Rab GTPases by the cytotoxic effector Makes Caterpillars Floppy

  Alfa Herrera, et al., bioRxiv - Microbiology 2023

  Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
• Vibrio MARTX toxin processing and degradation of cellular Rab GTPases by the cytotoxic effector Makes Caterpillars Floppy

  Alfa Herrera, et al., bioRxiv - Microbiology 2023

  Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
• Injectable Progranulin-derivative Atsttrin loaded Protein Engineered Gels for Post Traumatic Osteoarthritis

  Priya Katyal, et al., bioRxiv - Bioengineering 2021

  Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
• The Ruminococcus bromii amylosome protein Sas6 binds single and double helical α-glucan structures in starch

  Amanda L. Photenhauer, et al., bioRxiv - Molecular Biology 2022

  Quote: Custom α-Sas6T antiserum was generated by rabbit immunization with purified recombinant Sas6T protein (Lampire Biological Laboratories). The resulting antiserum was used for western blotting and cell staining ...
• Midbody remnant inheritance is regulated by the ESCRT subunit CHMP4C

  Javier Casares-Arias, et al., bioRxiv - Cell Biology 2020

  Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
• Glutamylation of Npm2 and Nap1 acidic disordered regions increases DNA charge mimicry to enhance chaperone efficiency

  Benjamin M. Lorton, et al., bioRxiv - Biochemistry 2023

  Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
• Hematopoietic-SLC37A2 deficiency accelerates atherosclerosis in LDL receptor-deficient mice

  Qingxia Zhao, et al., bioRxiv - Immunology 2021

  Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
• Glutamylation of Npm2 and Nap1 acidic disordered regions increases DNA charge mimicry to enhance chaperone efficiency

  Benjamin M. Lorton, et al., bioRxiv - Biochemistry 2023

  Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...