Labshake search
Citations for Lampire Biological Laboratories :
1 - 34 of 34 citations for PAS Domain Containing Serine threonine Protein Kinase PASK Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Neuroscience 2023Quote: ... blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30 min at RT ...
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Neuroscience 2020Quote: ... and then blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30min at RT ...
-
bioRxiv - Plant Biology 2022Quote: ... Fresh rat serum (Lampire Biological Laboratories, Pipersville, PA, USA) was shipped on wet ice ...
-
bioRxiv - Bioengineering 2022Quote: ... anticoagulated bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) containing acid citrate dextrose (ACD ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... 0.8% erythrocytes in PBS were added (Lampire Biologicals, Piperville, PA). For H1N1 ...
-
bioRxiv - Immunology 2020Quote: ... supplemented with 5% of sheep blood (LAMPIRE biological laboratories, PA) and incubated anaerobically with CO2 anaerobic pack (AnaeroPack® System ...
-
bioRxiv - Microbiology 2023Quote: ... and 10% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 10 minutes before staining with a primary monoclonal antibody that reacts with multiple flaviviruses (Flavivirus treatment antigen antibody D1-4G2-4-15 ...
-
bioRxiv - Biochemistry 2020Quote: ... supplemented with 5 % (v/v) sheep blood (Lampire Biological, Pipersville PA) or MH agar plates containing 1.5 % (m/v ...
-
bioRxiv - Bioengineering 2020Quote: We generated blood clots from bovine blood (Lampire Biological Laboratories, PA, USA) that was collected with CPDA-1 anticoagulant at 14% volume:volume and stored at 4°C for 12-72 hours prior to experimentation ...
-
bioRxiv - Immunology 2024Quote: ... 0.75% guinea pig red blood cells (GPRBCs) (Lampire Biologicals, Pipersville, PA, USA) for H3 subtype viruses in the presence of 20nM Oseltamivir ...
-
bioRxiv - Immunology 2019Quote: ... plates supplemented with 7% of Horse laked blood (Lampire Biological Laboratories, Pipersville, PA) and H ...
-
bioRxiv - Bioengineering 2023Quote: Citrated bovine calf whole blood was acquired through venipuncture (Lampire Biological Laboratories, PA) from a single donor animal ...
-
bioRxiv - Bioengineering 2021Quote: Porcine whole blood was obtained from a commercial source (Lampire Biological Laboratories, Pipersville, PA) in 1-liter quantities ...
-
bioRxiv - Physiology 2022Quote: Glossina morsitans morsitans flies were maintained on defibrinated bovine blood (Lampire Biologicals, Pipersville, PA, USA) at 25°C and 50-60% RH using an artificial membrane feeding system (Moloo ...
-
bioRxiv - Bioengineering 2023Quote: ... Sections were blocked in PBS with 5% normal goat serum (NGS; Lampire Biological, Pipersville, PA), 1% hydrogen peroxide ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... The warmed feeder was filled with ∼ 5 ml of heparinized bovine whole blood (Lampire Biological Laboratories, Pipersville, PA, USA) fifteen minutes prior to the beginning of the experiment to allow the blood to heat up ...
-
bioRxiv - Bioengineering 2023Quote: ... One tube (left side in Fig. S5a) was filled with defibrinated bovine blood (Lampire biological laboratories, Pipersville, PA, USA) while circulated using a peristatic pump (model 3386 ...
-
bioRxiv - Immunology 2021Quote: ... Hemagglutination activity of each preparation of VLP was determined by serially diluting volumes of VLPs and adding equal volume 0.8% turkey red blood cells (RBCs) (Lampire Biologicals, Pipersville, PA, USA) suspended in PBS to a V-bottom 96-well plate with a 30 min incubation at room temperature (RT) ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37°C using a circulating water-bath ...
-
bioRxiv - Neuroscience 2023Quote: ... An artificial feeder (D.E. Lillie Glassblowers, Atlanta, GA, USA; 2.5 cm internal diameter) filled with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) placed on the top of the cage and heated at 37°C using a water-bath circulation was used to feed mosquitoes weekly.
-
bioRxiv - Animal Behavior and Cognition 2024Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37 °C using a circulating water-bath ...
-
bioRxiv - Zoology 2020Quote: Mosquitoes were released into a covered 8 × 8 × 8” metal collapsible cage (BioQuip Products, Rancho Dominguez, CA) and allowed to feed on adult bovine blood (Lampire Biological Laboratories, Pipersville, PA). Blood was placed into a water bath-heated glass blood feeder (D.E ...
-
bioRxiv - Bioengineering 2023Quote: Whole blood clots were prepared from bovine blood collected with CPDA-1 anticoagulant at 14% volume anticoagulant/total volume and derived from a single donor animal (Lampire Biological Laboratories, PA,USA) (Sugerman et al. ...
-
bioRxiv - Neuroscience 2023Quote: ... after which 50 µl of PBS containing 0.04% BSA (from LAMPIRE Biological Laboratories Cell Culture Grade 35% BSA Liquid (Fisher Scientific Cat ...
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Molecular Biology 2022Quote: Custom α-Sas6T antiserum was generated by rabbit immunization with purified recombinant Sas6T protein (Lampire Biological Laboratories). The resulting antiserum was used for western blotting and cell staining ...
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.