Labshake search
Citations for Lampire Biological Laboratories :
1 - 6 of 6 citations for Mouse Anti Powassan Virus NS1 M954 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were blocked with 100 ug/mL mouse IgG (Lampire Biological Laboratories) or Human TruStain FcX (BioLegend) ...
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.