Labshake search
Citations for Lampire Biological Laboratories :
1 - 25 of 25 citations for Mouse Anti Bovine Coronavirus Spike Antibody 5A4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Biophysics 2022Quote: Pooled bovine SF (Lampire Biological Laboratories, 8600853) was used to prepare working aliquots ...
-
bioRxiv - Bioengineering 2020Quote: Bovine blood was purchased from Lampire Biologicals Laboratories (Bovine 7200807-1L ...
-
bioRxiv - Bioengineering 2022Quote: ... anticoagulated bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) containing acid citrate dextrose (ACD ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Bioengineering 2020Quote: We generated blood clots from bovine blood (Lampire Biological Laboratories, PA, USA) that was collected with CPDA-1 anticoagulant at 14% volume:volume and stored at 4°C for 12-72 hours prior to experimentation ...
-
bioRxiv - Bioengineering 2023Quote: Citrated bovine calf whole blood was acquired through venipuncture (Lampire Biological Laboratories, PA) from a single donor animal ...
-
bioRxiv - Genetics 2021Quote: ... adults were provided commercially available bovine blood treated with sodium citrate (Lampire Biological Laboratories). Egg rafts for microinjection were collected after 1-3 opportunities for blood-feeding ...
-
bioRxiv - Bioengineering 2021Quote: Young (1-2 weeks old) bovine knee joints were obtained from Vendors (Lampire biological laboratories), and cartilage explants were harvested from the trochlear groove using biopsy punch and cultured with chemically defined medium (DMEM ...
-
bioRxiv - Physiology 2022Quote: Glossina morsitans morsitans flies were maintained on defibrinated bovine blood (Lampire Biologicals, Pipersville, PA, USA) at 25°C and 50-60% RH using an artificial membrane feeding system (Moloo ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... The warmed feeder was filled with ∼ 5 ml of heparinized bovine whole blood (Lampire Biological Laboratories, Pipersville, PA, USA) fifteen minutes prior to the beginning of the experiment to allow the blood to heat up ...
-
bioRxiv - Bioengineering 2023Quote: ... One tube (left side in Fig. S5a) was filled with defibrinated bovine blood (Lampire biological laboratories, Pipersville, PA, USA) while circulated using a peristatic pump (model 3386 ...
-
bioRxiv - Developmental Biology 2022Quote: ... + 0.22 g glucose (MilliporeSigma, G7528) + 1.23 g sodium bicarbonate (MilliporeSigma, S5761) + 10 g fatty-acid free bovine serum albumin (FAF-BSA) (Lampire Biological Laboratories, 7500812) + 10 μL Insulin-Transferrin-Selenium-Ethanolamine (ITS-X ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37°C using a circulating water-bath ...
-
bioRxiv - Neuroscience 2023Quote: ... An artificial feeder (D.E. Lillie Glassblowers, Atlanta, GA, USA; 2.5 cm internal diameter) filled with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) placed on the top of the cage and heated at 37°C using a water-bath circulation was used to feed mosquitoes weekly.
-
bioRxiv - Animal Behavior and Cognition 2024Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37 °C using a circulating water-bath ...
-
bioRxiv - Zoology 2020Quote: Mosquitoes were released into a covered 8 × 8 × 8” metal collapsible cage (BioQuip Products, Rancho Dominguez, CA) and allowed to feed on adult bovine blood (Lampire Biological Laboratories, Pipersville, PA). Blood was placed into a water bath-heated glass blood feeder (D.E ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were blocked with 100 ug/mL mouse IgG (Lampire Biological Laboratories) or Human TruStain FcX (BioLegend) ...
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...