Labshake search

1 - 12 of 12 citations for Goat Anti Mouse IgG Fc HRP since 2019

• Targeted therapies prime oncogene-driven lung cancers for macrophage-mediated destruction

  Kyle Vaccaro, et al., bioRxiv - Cancer Biology 2023

  Quote: ... Cells were blocked with 100 ug/mL mouse IgG (Lampire Biological Laboratories) or Human TruStain FcX (BioLegend) ...
• Microbial exposure across life reduces susceptibility of Aedes aegypti to Zika virus by enhancing blood digestion and limiting midgut cell infection

  William Louie, et al., bioRxiv - Microbiology 2023

  Quote: ... and 10% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 10 minutes before staining with a primary monoclonal antibody that reacts with multiple flaviviruses (Flavivirus treatment antigen antibody D1-4G2-4-15 ...
• Quantifying the potential for red blood cell β-adrenergic sodium-proton exchangers to protect oxygen transport in hypoxic and hypercapnic white seabass

  Till S. Harter, et al., bioRxiv - Physiology 2021

  Quote: ... and 1% normal goat serum (Lampire Biological Laboratories 7332500; Pipersville, USA) in PBS and incubated for six hours on a rotator ...
• Impairment of the glial phagolysosomal system drives prion-like propagation in a Drosophila model of Huntington’s disease

  Graham H. Davis, et al., bioRxiv - Neuroscience 2023

  Quote: ... blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30 min at RT ...
• Microfluidic organotypic device to test intestinal mucosal barrier permeability ex vivo

  Amanda E Cherwin, et al., bioRxiv - Bioengineering 2023

  Quote: ... Sections were blocked in PBS with 5% normal goat serum (NGS; Lampire Biological, Pipersville, PA), 1% hydrogen peroxide ...
• Phagocytic glia are obligatory intermediates in transmission of mutant huntingtin aggregates across neuronal synapses

  Kirby M. Donnelly, et al., bioRxiv - Neuroscience 2020

  Quote: ... and then blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30min at RT ...
• Sex- and age- dependent effect of pre-gestational chronic stress and mirtazapine treatment on neurobehavioral development of offspring

  Viñas-Noguera Mireia, et al., bioRxiv - Animal Behavior and Cognition 2021

  Quote: ... Tissue was first treated with 0.6 % H2O2 for 30 minutes at room temperature and then incubated with 5% Normal Goat Serum (NGS) (Lampire Biological Laboratories) in Tris-Buffered Saline Tween at room temperature for 30 min to decrease probability of non-specific antibody binding ...
• Injectable Progranulin-derivative Atsttrin loaded Protein Engineered Gels for Post Traumatic Osteoarthritis

  Priya Katyal, et al., bioRxiv - Bioengineering 2021

  Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
• N-terminal autoprocessing and acetylation of MARTX Makes-Caterpillars Floppy-like effector is stimulated by ADP-Ribosylation Factor 1 in advance of Golgi fragmentation

  Alfa Herrera, et al., bioRxiv - Microbiology 2019

  Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
• Vibrio MARTX toxin processing and degradation of cellular Rab GTPases by the cytotoxic effector Makes Caterpillars Floppy

  Alfa Herrera, et al., bioRxiv - Microbiology 2023

  Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
• Vibrio MARTX toxin processing and degradation of cellular Rab GTPases by the cytotoxic effector Makes Caterpillars Floppy

  Alfa Herrera, et al., bioRxiv - Microbiology 2023

  Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
• Hematopoietic-SLC37A2 deficiency accelerates atherosclerosis in LDL receptor-deficient mice

  Qingxia Zhao, et al., bioRxiv - Immunology 2021

  Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.