Labshake search
Citations for Lampire Biological Laboratories :
1 - 4 of 4 citations for Choline Acetyltransferase Rabbit Polyclonal since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Molecular Biology 2022Quote: Custom α-Sas6T antiserum was generated by rabbit immunization with purified recombinant Sas6T protein (Lampire Biological Laboratories). The resulting antiserum was used for western blotting and cell staining ...