Labshake search
Citations for Lampire Biological Laboratories :
1 - 9 of 9 citations for Anti NFRKB Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Cell Biology 2020Quote: ... The rabbit polyclonal antibody to CHMP4C was prepared by Lampire Biologicals and used at 1/200 ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...