Labshake search
Citations for Lampire Biological Laboratories :
1 - 6 of 6 citations for Anti CD25 SAP human Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Microbiology 2019Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.