Labshake search
Citations for LifeSensors :
1 - 14 of 14 citations for Tick Borne Encephalitis Virus Envelope Protein Mouse Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... a commercial system with orthogonal cleavage sites based on the SUMOStar tag and SUMOStar protease (LifeSensors, USA) (Liu et al. ...
-
bioRxiv - Biochemistry 2022Quote: ... coli strain BL21 (DE3) with an N-terminal (His)6-SUMO tag from a pE-SUMO-pro expression vector (LifeSensors). Cells were grown in 2YT media at 24°C to an OD600 of 0.8 and then induced with 0.1 mM isopropyl β-D-thiogalactopyranoside (IPTG ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Cell Biology 2020Quote: ... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2023Quote: ... Arabidopsis KAI2 protein was expressed as a 6× His-SUMO fusion protein using the expression vector pSUMO (LifeSensors). His-SUMO-KAI2 was isolated from by Ni-NTA resin and the eluted His-SUMO KAI2 was further separated by anion-exchange ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1mg protein was added to 20μl of TUBE1 agarose (LifeSensors) and incubated for 2 hours at 4 °C ...
-
bioRxiv - Cell Biology 2020Quote: Ubiquitinated proteins were analysed using TUBE2 (Agarose, 30 µl per sample, UM402, LifeSensors), TUBE1 (magnetic beads ...
-
bioRxiv - Neuroscience 2022Quote: ... 850 µg protein was incubated with 80 µl equilibrated TUBE1 magnetic beads (LifeSensors) at 4 degrees Celsius for 2 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... Ubiquitinated proteins were pulled down from yeast lysates using Tandem Ubiquitin Binding Entities (TUBEs) (LifeSensors, UM402) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: Total Poly-ubiquitinated proteins were isolated using a LifeSensors Tandem Ubiquitin Binding Entities (TUBEs) Kit (LifeSensors, UM411M) and a modified protocol ...
-
bioRxiv - Neuroscience 2022Quote: ... 2 mg of total protein extract was incubated with 100 μL of pre-equilibrated Agarose-TUBEs (LifeSensors), overnight at 4°C on a rocking platform ...
-
bioRxiv - Biophysics 2019Quote: ... The plasmid containing the gene for human γS WT was engineered into the pE-SUMO (Small Ubiquitin-like Modifier) vector containing a N-terminal 6XHis tagged fusion protein (LifeSensors Inc., Malvern, PA). The γS N14D and γS N76D were generated via site-directed mutagenesis using QuikChangeXL Kit (Agilent Technologies ...
-
bioRxiv - Biochemistry 2022Quote: ... one with a 50:50 mix of the tanespimycin and mock-treated HT29 lysates (1 mg total protein) in the presence of control magnetic beads without any conjugated antibody (LifeSensors, catalog no. UM400M) (‘–IgG’) ...