Labshake search
Citations for LifeSensors :
1 - 13 of 13 citations for SARS CoV 2 Spike Glycoprotein S1 Sheep Fc Tag HEK293 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2021Quote: ... SARS-CoV-2 papain-like protease (DB604) was purchased from Lifesensors (Malvern, PA). HCoV-HKU1 coronavirus nucleocapsid protein ...
-
bioRxiv - Immunology 2021Quote: ... mice were injected intraperitoneally with 25 µg recombinant SARS-CoV-2 S2 (CV2006; LifeSensors) in monophosphoryl lipid A adjuvant (Sigma Adjuvant System ...
-
bioRxiv - Biophysics 2020Quote: ... SARS CoV-2 Mpro gene was subcloned from pET29a(+) to pE-SUMO vector according to manufacturer’s protocol (LifeSensors Inc, Malvern PA). pE-SUMO plasmid with SARS CoV-2 Main protease gene (Mpro ...
-
bioRxiv - Cell Biology 2022Quote: ... a commercial system with orthogonal cleavage sites based on the SUMOStar tag and SUMOStar protease (LifeSensors, USA) (Liu et al. ...
-
bioRxiv - Biochemistry 2022Quote: ... coli strain BL21 (DE3) with an N-terminal (His)6-SUMO tag from a pE-SUMO-pro expression vector (LifeSensors). Cells were grown in 2YT media at 24°C to an OD600 of 0.8 and then induced with 0.1 mM isopropyl β-D-thiogalactopyranoside (IPTG ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Microbiology 2020Quote: ... was added to sample 2 (DUBPAN) and 2 μl of OTUB1 (LifeSensors, Cat#: DB201) was added to sample 3 (DUBK48) ...
-
bioRxiv - Cell Biology 2021Quote: ... 2-10 µM of ubiquitin (LifeSensors si201), 10 µg of isolated ribosomes ...
-
bioRxiv - Animal Behavior and Cognition 2020Quote: ... 40 μl of Agarose-TUBEs 2 (UM402, LifeSensors) previously equilibrated in JS buffer ...
-
bioRxiv - Neuroscience 2023Quote: ... Cold TBST-washed pan-selective TUBE 2 beads (LifeSensors #UM-0402M) were incubated with neuron lysates overnight at 4°C with rotation ...
-
bioRxiv - Cell Biology 2020Quote: ... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... 2 mg of total protein extract was incubated with 100 μL of pre-equilibrated Agarose-TUBEs (LifeSensors), overnight at 4°C on a rocking platform ...