Labshake search
Citations for LifeSensors :
1 - 9 of 9 citations for Recombinant human IgE kappa L His tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... except that human recombinant Usp2Core (LifeSensors Inc., Malvern, PA) was used ...
-
bioRxiv - Biochemistry 2022Quote: ... coli strain BL21 (DE3) with an N-terminal (His)6-SUMO tag from a pE-SUMO-pro expression vector (LifeSensors). Cells were grown in 2YT media at 24°C to an OD600 of 0.8 and then induced with 0.1 mM isopropyl β-D-thiogalactopyranoside (IPTG ...
-
bioRxiv - Immunology 2021Quote: ... mice were injected intraperitoneally with 25 µg recombinant SARS-CoV-2 S2 (CV2006; LifeSensors) in monophosphoryl lipid A adjuvant (Sigma Adjuvant System ...
-
bioRxiv - Cell Biology 2022Quote: ... a commercial system with orthogonal cleavage sites based on the SUMOStar tag and SUMOStar protease (LifeSensors, USA) (Liu et al. ...
-
bioRxiv - Plant Biology 2023Quote: ... Arabidopsis KAI2 protein was expressed as a 6× His-SUMO fusion protein using the expression vector pSUMO (LifeSensors). His-SUMO-KAI2 was isolated from by Ni-NTA resin and the eluted His-SUMO KAI2 was further separated by anion-exchange ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Neuroscience 2023Quote: Human TDP-43 and TDP-43-GFP were subcloned into pE-SUMO (LifeSensors, Malvern, PA) as described (McGurk et al. ...
-
bioRxiv - Biochemistry 2020Quote: ... coli codon-optimized sequence of human full length Pol κ (accession no. NP057302) was cloned into a pE-SUMOpro expression vector (Lifesensors) using Gibson assembly technology ...