Labshake search
Citations for LifeSensors :
1 - 32 of 32 citations for Recombinant Human CD19 protein Fc tagged R PE labeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2019Quote: ... The plasmid containing the gene for human γS WT was engineered into the pE-SUMO (Small Ubiquitin-like Modifier) vector containing a N-terminal 6XHis tagged fusion protein (LifeSensors Inc., Malvern, PA). The γS N14D and γS N76D were generated via site-directed mutagenesis using QuikChangeXL Kit (Agilent Technologies ...
-
bioRxiv - Cell Biology 2020Quote: ... except that human recombinant Usp2Core (LifeSensors Inc., Malvern, PA) was used ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Neuroscience 2023Quote: Human TDP-43 and TDP-43-GFP were subcloned into pE-SUMO (LifeSensors, Malvern, PA) as described (McGurk et al. ...
-
bioRxiv - Biochemistry 2023Quote: ... pE-SUMOpro (LifeSensors). Mutations were introduced into the generated pE-SUMO-α-actinin-2 ABD through site-directed PCR mutagenesis (PfuUltra High-Fidelity DNA Polymerase ...
-
bioRxiv - Biochemistry 2020Quote: ... coli codon-optimized sequence of human full length Pol κ (accession no. NP057302) was cloned into a pE-SUMOpro expression vector (Lifesensors) using Gibson assembly technology ...
-
bioRxiv - Molecular Biology 2019Quote: ... and cloned into pE-SUMO (LifeSensors), resulting in plasmid 3410 (Supplementary Table 8) ...
-
CXCL17 binds efficaciously to glycosaminoglycans with the potential to modulate chemokine signallingbioRxiv - Immunology 2023Quote: The pE-SUMOpro3 AMP vector (Lifesensors Inc, PA, USA) was modified by site-directed mutagenesis to insert a silent AgeI restriction site in the final codon of the SUMO3 open reading frame (ORF) ...
-
bioRxiv - Biochemistry 2023Quote: ... An expression vector was derived from pE-SUMOpro (LifeSensors) to encode a dual-strep tag followed by a TEV protease site between the SUMO tag and MCS (His-SUMO-dual strep-TEV-PGT) ...
-
bioRxiv - Microbiology 2021Quote: ... It was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Nco I and Xho I restriction sites ...
-
bioRxiv - Biochemistry 2022Quote: ... Kapβ2 ORFs were cloned into a pE-SUMOpro Amp vector (LifeSensors) using the following strategy ...
-
bioRxiv - Molecular Biology 2021Quote: The PCR product was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Bsa I and Xho I restriction sites ...
-
bioRxiv - Molecular Biology 2022Quote: ... ishimotonii CRISPR locus and cloned into the modified pE-SUMO vector (LifeSensors), in which the SUMO-coding region is replaced with the HRV3C protease recognition site ...
-
bioRxiv - Microbiology 2021Quote: ... The synthetic DNA fragments were cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Kif I and Xho I sites ...
-
bioRxiv - Immunology 2021Quote: ... mice were injected intraperitoneally with 25 µg recombinant SARS-CoV-2 S2 (CV2006; LifeSensors) in monophosphoryl lipid A adjuvant (Sigma Adjuvant System ...
-
bioRxiv - Biochemistry 2019Quote: ... aeruginosa PAO1 EF-Tu (tufB) coding sequence from plasmid pJP04 (9) into the pE-SUMO vector (LifeSensors). This construct produces His6-SUMO-EF-Tu protein (“SUMO-L0-EF-Tu” ...
-
bioRxiv - Biochemistry 2022Quote: ... coli strain BL21 (DE3) with an N-terminal (His)6-SUMO tag from a pE-SUMO-pro expression vector (LifeSensors). Cells were grown in 2YT media at 24°C to an OD600 of 0.8 and then induced with 0.1 mM isopropyl β-D-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cell Biology 2020Quote: ... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2023Quote: ... Arabidopsis KAI2 protein was expressed as a 6× His-SUMO fusion protein using the expression vector pSUMO (LifeSensors). His-SUMO-KAI2 was isolated from by Ni-NTA resin and the eluted His-SUMO KAI2 was further separated by anion-exchange ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Biophysics 2020Quote: ... SARS CoV-2 Mpro gene was subcloned from pET29a(+) to pE-SUMO vector according to manufacturer’s protocol (LifeSensors Inc, Malvern PA). pE-SUMO plasmid with SARS CoV-2 Main protease gene (Mpro ...
-
bioRxiv - Microbiology 2020Quote: ... LIM4 aa 213-280) were obtained as synthetic DNA fragments from IDT and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) as fusions with SUMO.
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... Then the SARS-CoV PLpro gene (ORF 1ab 1541-1855) was subcloned from the pET28b-(+) to pE-SUMO vector according to the manufacturer’s protocol (LifeSensors Inc., Malvern, PA). The forward primer with the Bsa I site is GCGGTCTCAAGGTGAGGTGAAGACCATCAAAGTGTTCACCACC ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... the SARS-CoV-2 PLpro gene (ORF 1ab 1564−1876) was subcloned from pET28b(+) to pE-SUMO vector according to the manufacturer’s protocol (LifeSensors Inc., Malvern, PA). The forward primer with the Bsa I site is GCGGTCTCAAGGTGAAGTTCGCACCATCAAAGTTTTTACC ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1mg protein was added to 20μl of TUBE1 agarose (LifeSensors) and incubated for 2 hours at 4 °C ...
-
bioRxiv - Cell Biology 2020Quote: Ubiquitinated proteins were analysed using TUBE2 (Agarose, 30 µl per sample, UM402, LifeSensors), TUBE1 (magnetic beads ...
-
bioRxiv - Neuroscience 2022Quote: ... 850 µg protein was incubated with 80 µl equilibrated TUBE1 magnetic beads (LifeSensors) at 4 degrees Celsius for 2 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... Ubiquitinated proteins were pulled down from yeast lysates using Tandem Ubiquitin Binding Entities (TUBEs) (LifeSensors, UM402) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: Total Poly-ubiquitinated proteins were isolated using a LifeSensors Tandem Ubiquitin Binding Entities (TUBEs) Kit (LifeSensors, UM411M) and a modified protocol ...
-
bioRxiv - Neuroscience 2022Quote: ... 2 mg of total protein extract was incubated with 100 μL of pre-equilibrated Agarose-TUBEs (LifeSensors), overnight at 4°C on a rocking platform ...
-
bioRxiv - Biochemistry 2022Quote: ... one with a 50:50 mix of the tanespimycin and mock-treated HT29 lysates (1 mg total protein) in the presence of control magnetic beads without any conjugated antibody (LifeSensors, catalog no. UM400M) (‘–IgG’) ...