Labshake search
Citations for LifeSensors :
1 - 26 of 26 citations for Rat Macrophage expressed gene 1 protein MPEG1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2023Quote: ... Arabidopsis KAI2 protein was expressed as a 6× His-SUMO fusion protein using the expression vector pSUMO (LifeSensors). His-SUMO-KAI2 was isolated from by Ni-NTA resin and the eluted His-SUMO KAI2 was further separated by anion-exchange ...
-
bioRxiv - Genetics 2024Quote: The UbiQuant ELISA kit as directed by the manufacturer (LifeSensors, Malvern, PA) was used to determine the absolute and total amount of ubiquitin and ubiquitylated proteins in the RPE ...
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Cell Biology 2023Quote: ... The LIAS gene was subcloned into a modified pSUMO vector (LifeSensors Inc.), (pDWSUMO) ...
-
bioRxiv - Cell Biology 2022Quote: Total Poly-ubiquitinated proteins were isolated using a LifeSensors Tandem Ubiquitin Binding Entities (TUBEs) Kit (LifeSensors, UM411M) and a modified protocol ...
-
bioRxiv - Cell Biology 2020Quote: ... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2022Quote: ... one with a 50:50 mix of the tanespimycin and mock-treated HT29 lysates (1 mg total protein) in the presence of control magnetic beads without any conjugated antibody (LifeSensors, catalog no. UM400M) (‘–IgG’) ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Biophysics 2020Quote: ... SARS CoV-2 Mpro gene was subcloned from pET29a(+) to pE-SUMO vector according to manufacturer’s protocol (LifeSensors Inc, Malvern PA). pE-SUMO plasmid with SARS CoV-2 Main protease gene (Mpro ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... the SARS-CoV-2 PLpro gene (ORF 1ab 1564−1876) was subcloned from pET28b(+) to pE-SUMO vector according to the manufacturer’s protocol (LifeSensors Inc., Malvern, PA). The forward primer with the Bsa I site is GCGGTCTCAAGGTGAAGTTCGCACCATCAAAGTTTTTACC ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1mg protein was added to 20μl of TUBE1 agarose (LifeSensors) and incubated for 2 hours at 4 °C ...
-
bioRxiv - Cell Biology 2020Quote: Ubiquitinated proteins were analysed using TUBE2 (Agarose, 30 µl per sample, UM402, LifeSensors), TUBE1 (magnetic beads ...
-
bioRxiv - Neuroscience 2022Quote: ... 850 µg protein was incubated with 80 µl equilibrated TUBE1 magnetic beads (LifeSensors) at 4 degrees Celsius for 2 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... Ubiquitinated proteins were pulled down from yeast lysates using Tandem Ubiquitin Binding Entities (TUBEs) (LifeSensors, UM402) according to the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-ubiquitin (1:10,000; LifeSensors; Mab; clone VU-1), anti-K63 (1:1,000 ...
-
bioRxiv - Neuroscience 2022Quote: ... 2 mg of total protein extract was incubated with 100 μL of pre-equilibrated Agarose-TUBEs (LifeSensors), overnight at 4°C on a rocking platform ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Ubiquitin (1:200; LifeSensors, AB120), and anti-Vimentin (1:400 ...
-
bioRxiv - Biophysics 2019Quote: ... The plasmid containing the gene for human γS WT was engineered into the pE-SUMO (Small Ubiquitin-like Modifier) vector containing a N-terminal 6XHis tagged fusion protein (LifeSensors Inc., Malvern, PA). The γS N14D and γS N76D were generated via site-directed mutagenesis using QuikChangeXL Kit (Agilent Technologies ...
-
bioRxiv - Molecular Biology 2022Quote: ... Immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... and immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Microbiology 2020Quote: ... 1 μl of USP2 (LifeSensors, Cat#: DB501) was added to sample 2 (DUBPAN ...
-
bioRxiv - Molecular Biology 2023Quote: ... and incubating with either 2.5 µl (∼25 units) of SUMOstar Protease 1 (LifeSensors) for constructs in SUMOstar vectors or with SUMO Protease (Thermo Fisher ...
-
bioRxiv - Cell Biology 2021Quote: ... VU101: Anti-ubiquitin Antibody (VU-0101, 1:1000) was purchased from LifeSensors (PA, USA). Anti-mouse HRP conjugate (W4021 ...
-
bioRxiv - Biochemistry 2020Quote: ... cells were harvested and resuspended in TUBE lysis buffer (50mM Tris-HCl, pH 7.5, 0.15M NaCl, 1mM EDTA, 1% NP-40, 10% glycerol, published by LifeSensors, Inc.) with 1X protease inhibitor cocktail (Bimake ...
-
bioRxiv - Biochemistry 2021Quote: ... 125 nM USP51–835 was added and the plate was incubated at room temperature for 1 hour before the addition of 200 nM IQF Ub2K48 (LifeSensors, DU4802). Following a 1-minute centrifugation at 250 g ...