Labshake search
Citations for LifeSensors :
1 - 17 of 17 citations for Puumala Virus Glycoprotein 1 Gn Human Fc tag since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... a commercial system with orthogonal cleavage sites based on the SUMOStar tag and SUMOStar protease (LifeSensors, USA) (Liu et al. ...
-
bioRxiv - Biochemistry 2022Quote: ... coli strain BL21 (DE3) with an N-terminal (His)6-SUMO tag from a pE-SUMO-pro expression vector (LifeSensors). Cells were grown in 2YT media at 24°C to an OD600 of 0.8 and then induced with 0.1 mM isopropyl β-D-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cell Biology 2020Quote: ... except that human recombinant Usp2Core (LifeSensors Inc., Malvern, PA) was used ...
-
bioRxiv - Biophysics 2022Quote: The sequence-optimised UvrD gene tagged with 8xHis-tag at the N-terminus was cloned into pE-SUMO expression vector (Lifesensors Inc.) using Gibson reaction ...
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Neuroscience 2023Quote: Human TDP-43 and TDP-43-GFP were subcloned into pE-SUMO (LifeSensors, Malvern, PA) as described (McGurk et al. ...
-
bioRxiv - Biochemistry 2020Quote: ... coli codon-optimized sequence of human full length Pol κ (accession no. NP057302) was cloned into a pE-SUMOpro expression vector (Lifesensors) using Gibson assembly technology ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-ubiquitin (1:10,000; LifeSensors; Mab; clone VU-1), anti-K63 (1:1,000 ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Ubiquitin (1:200; LifeSensors, AB120), and anti-Vimentin (1:400 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... and immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Microbiology 2020Quote: ... 1 μl of USP2 (LifeSensors, Cat#: DB501) was added to sample 2 (DUBPAN ...
-
bioRxiv - Molecular Biology 2023Quote: ... and incubating with either 2.5 µl (∼25 units) of SUMOstar Protease 1 (LifeSensors) for constructs in SUMOstar vectors or with SUMO Protease (Thermo Fisher ...
-
bioRxiv - Cell Biology 2021Quote: ... VU101: Anti-ubiquitin Antibody (VU-0101, 1:1000) was purchased from LifeSensors (PA, USA). Anti-mouse HRP conjugate (W4021 ...
-
bioRxiv - Biochemistry 2020Quote: ... cells were harvested and resuspended in TUBE lysis buffer (50mM Tris-HCl, pH 7.5, 0.15M NaCl, 1mM EDTA, 1% NP-40, 10% glycerol, published by LifeSensors, Inc.) with 1X protease inhibitor cocktail (Bimake ...
-
bioRxiv - Biochemistry 2021Quote: ... 125 nM USP51–835 was added and the plate was incubated at room temperature for 1 hour before the addition of 200 nM IQF Ub2K48 (LifeSensors, DU4802). Following a 1-minute centrifugation at 250 g ...
-
bioRxiv - Biochemistry 2022Quote: ... one with a 50:50 mix of the tanespimycin and mock-treated HT29 lysates (1 mg total protein) in the presence of control magnetic beads without any conjugated antibody (LifeSensors, catalog no. UM400M) (‘–IgG’) ...