Labshake search
Citations for LifeSensors :
1 - 10 of 10 citations for 7 methylsulfanyl 4 oxo 1H quinoline 3 carboxylic acid since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: ... It was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Nco I and Xho I restriction sites ...
-
bioRxiv - Biochemistry 2021Quote: ... FAM20C (amino acids 93-584) was subcloned into a modified pI-secSUMOstar vector (LifeSensors, Malvern, PA) in which the original SUMO tag was replaced by a MBP tag and tobacco etch virus (TEV ...
-
bioRxiv - Molecular Biology 2021Quote: The PCR product was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Bsa I and Xho I restriction sites ...
-
bioRxiv - Microbiology 2021Quote: ... The synthetic DNA fragments were cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Kif I and Xho I sites ...
-
bioRxiv - Pathology 2021Quote: ... PRR4 cDNA without a signal peptide sequence (corresponding to amino acids 17 to 134) was cloned into the pM-secSUMOstar Vector (7121, LifeSensors). SUMOstar-PRR4 vectors were transfected into Expi293 cells (1 mg of DNA per liter of transfection ...
-
bioRxiv - Molecular Biology 2023Quote: ... 600 µg of WCE was mixed with 2 µg of α-FLAG antibody in a total volume of 400 µL WCE buffer that had been mock treated or treated with 3 µg of K48ub or K63ub linkage specific Tandem Ubiquitin Binding Entities (TUBEs) purchased from LifeSensors. Samples were rotated at 4°C for a minimum of two hours before adding Protein A agarose beads and rotating at 4°C for an additional one hour to capture the immune complexes ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... LIM4 aa 213-280) were obtained as synthetic DNA fragments from IDT and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) as fusions with SUMO.
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Biochemistry 2022Quote: ... Ubiquitin transfer from HOIP RBR to the substrate (TAMRA-ubiquitin) was performed on ice and induced by addition of 4 µM fluorescent TAMRA-ubiquitin (LifeSensors SI270T ...