Labshake search
Citations for LifeSensors :
1 - 24 of 24 citations for 7 TRIFLUOROMETHYL 2 3 4 5 TETRAHYDRO 1H BENZO B AZEPINE HYDROCHLORIDE since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2019Quote: ... 5 (LifeSensors) FRET-K48 diubiquitin ...
-
bioRxiv - Biochemistry 2020Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol] containing SUMO protease (LifeSensors) in order to cleave the SUMO tag and generate Pol κ in the native form ...
-
bioRxiv - Biochemistry 2022Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol) in the presence of SUMO protease (LifeSensors) to remove the SUMO tag to generate native PolH ...
-
bioRxiv - Cell Biology 2019Quote: ... and 5 μM 1,10-phenanthroline (LifeSensors) were added in the lysis buffer for ubiquitin detection by western blotting ...
-
bioRxiv - Microbiology 2020Quote: ... was added to sample 2 (DUBPAN) and 2 μl of OTUB1 (LifeSensors, Cat#: DB201) was added to sample 3 (DUBK48) ...
-
bioRxiv - Microbiology 2021Quote: ... It was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Nco I and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mM 1,10-phenanthroline (LifeSensors, Cat#: SI9649), and 1 μl/ml Benzonase (Sigma-Alrich) ...
-
bioRxiv - Cell Biology 2023Quote: ... 5 µg/mL PR-619 (SI9619, LifeSensors), 20 µM MG132 (474790 ...
-
bioRxiv - Molecular Biology 2021Quote: The PCR product was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Bsa I and Xho I restriction sites ...
-
bioRxiv - Cell Biology 2021Quote: ... 2-10 µM of ubiquitin (LifeSensors si201), 10 µg of isolated ribosomes ...
-
bioRxiv - Microbiology 2021Quote: ... The synthetic DNA fragments were cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Kif I and Xho I sites ...
-
bioRxiv - Animal Behavior and Cognition 2020Quote: ... 40 μl of Agarose-TUBEs 2 (UM402, LifeSensors) previously equilibrated in JS buffer ...
-
bioRxiv - Neuroscience 2024Quote: ... and 5 mM 1,10-phenanthroline (o-PA) (100X, #SI9649, LifeSensors). The total protein content of the lysates was determined by BCA protein assay (#23227 ...
-
bioRxiv - Neuroscience 2023Quote: ... Cold TBST-washed pan-selective TUBE 2 beads (LifeSensors #UM-0402M) were incubated with neuron lysates overnight at 4°C with rotation ...
-
bioRxiv - Immunology 2021Quote: ... SARS-CoV-2 papain-like protease (DB604) was purchased from Lifesensors (Malvern, PA). HCoV-HKU1 coronavirus nucleocapsid protein ...
-
bioRxiv - Molecular Biology 2023Quote: ... 600 µg of WCE was mixed with 2 µg of α-FLAG antibody in a total volume of 400 µL WCE buffer that had been mock treated or treated with 3 µg of K48ub or K63ub linkage specific Tandem Ubiquitin Binding Entities (TUBEs) purchased from LifeSensors. Samples were rotated at 4°C for a minimum of two hours before adding Protein A agarose beads and rotating at 4°C for an additional one hour to capture the immune complexes ...
-
bioRxiv - Immunology 2021Quote: ... mice were injected intraperitoneally with 25 µg recombinant SARS-CoV-2 S2 (CV2006; LifeSensors) in monophosphoryl lipid A adjuvant (Sigma Adjuvant System ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... LIM4 aa 213-280) were obtained as synthetic DNA fragments from IDT and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) as fusions with SUMO.
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Biochemistry 2022Quote: ... Ubiquitin transfer from HOIP RBR to the substrate (TAMRA-ubiquitin) was performed on ice and induced by addition of 4 µM fluorescent TAMRA-ubiquitin (LifeSensors SI270T ...
-
bioRxiv - Cell Biology 2020Quote: ... The pull-down of ubiquitinated proteins from protein extracts was performed with TUBE 2 agarose beads (LifeSensors), following the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2022Quote: ... 2 mg of total protein extract was incubated with 100 μL of pre-equilibrated Agarose-TUBEs (LifeSensors), overnight at 4°C on a rocking platform ...
-
bioRxiv - Biophysics 2020Quote: ... SARS CoV-2 Mpro gene was subcloned from pET29a(+) to pE-SUMO vector according to manufacturer’s protocol (LifeSensors Inc, Malvern PA). pE-SUMO plasmid with SARS CoV-2 Main protease gene (Mpro ...