Labshake search
Citations for LifeSensors :
1 - 25 of 25 citations for 7 8 DIHYDRO 1 3 DIOXOLO 4 5 G ISOQUINOLIN 5 6H ONE since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2019Quote: ... 5 (LifeSensors) FRET-K48 diubiquitin ...
-
bioRxiv - Biochemistry 2020Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol] containing SUMO protease (LifeSensors) in order to cleave the SUMO tag and generate Pol κ in the native form ...
-
bioRxiv - Biochemistry 2022Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol) in the presence of SUMO protease (LifeSensors) to remove the SUMO tag to generate native PolH ...
-
bioRxiv - Cell Biology 2019Quote: ... and 5 μM 1,10-phenanthroline (LifeSensors) were added in the lysis buffer for ubiquitin detection by western blotting ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mM 1,10-phenanthroline (LifeSensors, Cat#: SI9649), and 1 μl/ml Benzonase (Sigma-Alrich) ...
-
bioRxiv - Cell Biology 2023Quote: ... 5 µg/mL PR-619 (SI9619, LifeSensors), 20 µM MG132 (474790 ...
-
bioRxiv - Neuroscience 2024Quote: ... and 5 mM 1,10-phenanthroline (o-PA) (100X, #SI9649, LifeSensors). The total protein content of the lysates was determined by BCA protein assay (#23227 ...
-
bioRxiv - Microbiology 2021Quote: ... It was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Nco I and Xho I restriction sites ...
-
bioRxiv - Molecular Biology 2021Quote: The PCR product was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Bsa I and Xho I restriction sites ...
-
bioRxiv - Microbiology 2021Quote: ... The synthetic DNA fragments were cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Kif I and Xho I sites ...
-
bioRxiv - Molecular Biology 2023Quote: ... 600 µg of WCE was mixed with 2 µg of α-FLAG antibody in a total volume of 400 µL WCE buffer that had been mock treated or treated with 3 µg of K48ub or K63ub linkage specific Tandem Ubiquitin Binding Entities (TUBEs) purchased from LifeSensors. Samples were rotated at 4°C for a minimum of two hours before adding Protein A agarose beads and rotating at 4°C for an additional one hour to capture the immune complexes ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... LIM4 aa 213-280) were obtained as synthetic DNA fragments from IDT and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) as fusions with SUMO.
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-ubiquitin (1:10,000; LifeSensors; Mab; clone VU-1), anti-K63 (1:1,000 ...
-
bioRxiv - Biochemistry 2022Quote: ... Ubiquitin transfer from HOIP RBR to the substrate (TAMRA-ubiquitin) was performed on ice and induced by addition of 4 µM fluorescent TAMRA-ubiquitin (LifeSensors SI270T ...
-
bioRxiv - Cell Biology 2023Quote: ... anti-Ubiquitin (1:200; LifeSensors, AB120), and anti-Vimentin (1:400 ...
-
bioRxiv - Molecular Biology 2022Quote: ... Immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Cell Biology 2020Quote: ... and immunoblotting was performed using the following primary antibodies: anti-ubiquitin (1:10,000; LifeSensors; MAb; clone VU-1), anti-K48 (1:10,000 ...
-
bioRxiv - Microbiology 2020Quote: ... 1 μl of USP2 (LifeSensors, Cat#: DB501) was added to sample 2 (DUBPAN ...
-
bioRxiv - Molecular Biology 2023Quote: ... and incubating with either 2.5 µl (∼25 units) of SUMOstar Protease 1 (LifeSensors) for constructs in SUMOstar vectors or with SUMO Protease (Thermo Fisher ...
-
bioRxiv - Cell Biology 2021Quote: ... VU101: Anti-ubiquitin Antibody (VU-0101, 1:1000) was purchased from LifeSensors (PA, USA). Anti-mouse HRP conjugate (W4021 ...
-
bioRxiv - Biochemistry 2020Quote: ... cells were harvested and resuspended in TUBE lysis buffer (50mM Tris-HCl, pH 7.5, 0.15M NaCl, 1mM EDTA, 1% NP-40, 10% glycerol, published by LifeSensors, Inc.) with 1X protease inhibitor cocktail (Bimake ...
-
bioRxiv - Biochemistry 2021Quote: ... 125 nM USP51–835 was added and the plate was incubated at room temperature for 1 hour before the addition of 200 nM IQF Ub2K48 (LifeSensors, DU4802). Following a 1-minute centrifugation at 250 g ...
-
bioRxiv - Biochemistry 2022Quote: ... one with a 50:50 mix of the tanespimycin and mock-treated HT29 lysates (1 mg total protein) in the presence of control magnetic beads without any conjugated antibody (LifeSensors, catalog no. UM400M) (‘–IgG’) ...