Labshake search
Citations for LifeSensors :
1 - 14 of 14 citations for 5 Cyanopyridin 3 yl methanol since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2019Quote: ... 5 (LifeSensors) FRET-K48 diubiquitin ...
-
bioRxiv - Biochemistry 2020Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol] containing SUMO protease (LifeSensors) in order to cleave the SUMO tag and generate Pol κ in the native form ...
-
bioRxiv - Biochemistry 2022Quote: ... 5 mM β-Mercaptoethanol and 5% Glycerol) in the presence of SUMO protease (LifeSensors) to remove the SUMO tag to generate native PolH ...
-
bioRxiv - Cell Biology 2019Quote: ... and 5 μM 1,10-phenanthroline (LifeSensors) were added in the lysis buffer for ubiquitin detection by western blotting ...
-
bioRxiv - Microbiology 2021Quote: ... It was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Nco I and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... 5 mM 1,10-phenanthroline (LifeSensors, Cat#: SI9649), and 1 μl/ml Benzonase (Sigma-Alrich) ...
-
bioRxiv - Cell Biology 2023Quote: ... 5 µg/mL PR-619 (SI9619, LifeSensors), 20 µM MG132 (474790 ...
-
bioRxiv - Molecular Biology 2021Quote: The PCR product was cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Bsa I and Xho I restriction sites ...
-
bioRxiv - Microbiology 2021Quote: ... The synthetic DNA fragments were cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) between Kif I and Xho I sites ...
-
bioRxiv - Neuroscience 2024Quote: ... and 5 mM 1,10-phenanthroline (o-PA) (100X, #SI9649, LifeSensors). The total protein content of the lysates was determined by BCA protein assay (#23227 ...
-
bioRxiv - Molecular Biology 2023Quote: ... 600 µg of WCE was mixed with 2 µg of α-FLAG antibody in a total volume of 400 µL WCE buffer that had been mock treated or treated with 3 µg of K48ub or K63ub linkage specific Tandem Ubiquitin Binding Entities (TUBEs) purchased from LifeSensors. Samples were rotated at 4°C for a minimum of two hours before adding Protein A agarose beads and rotating at 4°C for an additional one hour to capture the immune complexes ...
-
bioRxiv - Molecular Biology 2021Quote: ... The synthetic gene blocks encoding mutant nsp1 were ordered from Integrated DNA Technologies and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc) between Eco RI and Xho I restriction sites ...
-
bioRxiv - Microbiology 2020Quote: ... LIM4 aa 213-280) were obtained as synthetic DNA fragments from IDT and cloned into pE-SUMOpro-3 plasmid (LifeSensors Inc.) as fusions with SUMO.
-
bioRxiv - Microbiology 2020Quote: ... of strain 181/25 was expressed as a fusion with Twin-Strep-tag (GSWSHPQFEKGGGSGGGSGGGSWSHPQFEK) from pE-SUMOpro-3 plasmid (LifeSensors Inc.) in E ...