Recombinant Mouse Anti-E.coli recA Antibody (ARM191)
This product is a mouse monoclonal antibody that specifically recognizes EKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIE, which is an linear epitope on recombinase A from Escherichia coli. The recA-binding antibody ARM191 is an epitope-specific antibody that can be used in ELISA.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1604LC |
| Pricing | Inquiry |
| Host | Mouse |
| Target | recA |
| Species Reactivity | E. coli |
| Type | IgG |
| Applications | Enzyme-linked Immunosorbent Assay |