Recombinant Mouse Anti-C. trachomatis L2 MOMP Antibody (L21-10)
This product is a mouse monoclonal antibody that specifically recognizes SATTVFDVTTLNPTIAGAGDVKASAEGQLG, which is an linear epitope on Major outer membrane porin from Chlamydia trachomatis Serovar L2. The MOMP-binding antibody L21-10 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1587LC |
| Pricing | Inquiry |
| Applications | Western Blot |
| Host | Mouse |
| Target | MOMP |
| Species Reactivity | C. trachomatis Serovar L2 |