Recombinant Mouse Anti-E.coli cfaB Antibody (MAb 65D)
This product is a mouse monoclonal antibody that specifically recognizes VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVM, which is an linear epitope on CFA/I fimbrial subunit B from Escherichia coli. The cfaB-binding antibody MAb 65D is an epitope-specific antibody that can be used in blocking study and ELISA.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1219LC |
| Pricing | Inquiry |
| Host | Mouse |
| Target | cfaB |
| Species Reactivity | E. coli |
| Type | IgG1 |
| Applications | Blocking, Enzyme-linked Immunosorbent Assay |