Recombinant Mouse Anti-RABV (RCEH) NP Antibody (MoAb 6)
This product is a mouse monoclonal antibody that specifically recognizes AIKDLKKPCITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCS, which is an linear epitope on Nucleoprotein from Rabies virus RCEH. The NP-binding antibody MoAb 6 is an epitope-specific antibody that can be used in blocking study.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1206LC |
| Pricing | Inquiry |
| Applications | Blocking |
| Host | Mouse |
| Target | NP |
| Species Reactivity | Rabies virus RCEH |