Parstatin (human)
| Supplier | Creative Peptides |
|---|---|
| Product # | GR2141 |
| CAS # | 1065755-99-8 |
| Pricing | Inquire |
| Synonyms | Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo. |
| MolecularFormula | C191H330N64O53S3 |
| MolecularWeight | 4467.29 |
| Sequence | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
| Storage | -20°C |