Recombinant Mouse Anti-E.coli atpA Antibody (alphaII)
This product is a mouse monoclonal antibody that specifically recognizes NTLGAPIDGKGPLDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAV, which is an linear epitope on ATP synthase alpha subunit from Escherichia coli. The atpA-binding antibody alphaII is an epitope-specific antibody that can be used in western blotting.
Supplier | Creative Biolabs |
---|---|
Product # | EPAF-1683LC |
Pricing | Inquiry |
Host | Mouse |
Target | atpA |
Species Reactivity | E. coli |
Type | IgG1 |
Applications | Western Blot |