Recombinant Mouse Anti-E.coli atpA Antibody (alphaII)
This product is a mouse monoclonal antibody that specifically recognizes NTLGAPIDGKGPLDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAV, which is an linear epitope on ATP synthase alpha subunit from Escherichia coli. The atpA-binding antibody alphaII is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1683LC |
| Pricing | Inquiry |
| Host | Mouse |
| Target | atpA |
| Species Reactivity | E. coli |
| Type | IgG1 |
| Applications | Western Blot |