Recombinant Mouse Anti-H1N1 M1 Antibody (M1-289/4)
This product is a mouse monoclonal antibody that specifically recognizes GLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQ, which is an linear epitope on Matrix protein 1 from Influenza A virus H1N1. The M1-binding antibody M1-289/4 is an epitope-specific antibody that can be used in western blotting.
| Supplier | Creative Biolabs |
|---|---|
| Product # | EPAF-1110LC |
| Pricing | Inquiry |
| Applications | Western Blot |
| Host | Mouse |
| Target | M1 |
| Species Reactivity | Influenza A virus H1N1 |